KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0990
Entry
lpg0990           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Other DBs
NCBI-GeneID: 19832556
NCBI-ProteinID: YP_095023
Pasteur: lpg0990
UniProt: Q5ZWU5
Position
complement(1085247..1085570)
AA seq 107 aa
MIMLCGSLALSACSTTNISQSAIPEQGLTVSQLYQQSLQQPIQKPVYQKVSLDSSGEEFK
QLPNPEVPIHVFAHVAQLGDEQIIKPAYTTRFFLYKQNQYALASELY
NT seq 324 nt   +upstreamnt  +downstreamnt
ttgataatgctttgcggtagtctggctttgagtgcttgctcaaccaccaatatatcccaa
agcgcgattcctgagcagggtttaacggtcagccagttgtatcagcagagcctacaacaa
ccaatacaaaagcctgtttatcagaaggttagcctcgattcgtcaggagaggaattcaaa
caactgcctaacccagaagtgccgattcatgtttttgctcatgtagcgcaattgggcgat
gaacaaatcatcaaaccagcctacaccacacgcttttttctttataagcaaaaccagtat
gccctggcatcggaactgtattaa

DBGET integrated database retrieval system