KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg1000Help
Entry
lpg1000           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 19832565
NCBI-ProteinID: YP_095033
Pasteur: lpg1000
UniProt: Q5ZWT5
Position
complement(1090611..1091432)
Genome map
AA seq 273 aa AA seqDB search
MNKLSTITLCLLLGQQAIAGLYIPGIATSPMQQADNALAKAGLTEFHDEVIEEKDFLLND
VQKQEAKIWGLNEKEEKRYLQLMQSRSGVYYKDLRMTPVDILGLNARDDAEREHFASLAA
RQEAQKVAQNIAWNNAFYKAYNELFKDVPVVGDFDPSPYSPYAHQPIQLKAGETLYLFIR
PDDAVTTIILQLIDAINRTPNTKLNLLFLDMDNNTIQLWANRHQIPIQLVTSQQITLTPG
NQQFEGLTLAKKQTPLLLIANGKTSQVVDLGRF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattgtctaccatcactctatgcctgttattaggccagcaagccatcgcaggt
ttgtatatccctggcattgccacctcacccatgcaacaagccgacaatgccctagcaaaa
gcaggtcttactgagtttcatgatgaagtgatcgaagaaaaggatttcctactgaatgat
gttcaaaagcaagaagctaaaatctggggattgaatgaaaaagaagaaaaacgctatctg
caattaatgcaaagccgaagcggtgtgtattacaaagacttacgcatgacaccggttgat
atcctgggacttaatgccagagatgatgcggaacgtgagcattttgccagtctggctgct
cgccaggaagcgcaaaaggtggcgcaaaatatcgcttggaacaatgccttttacaaagcg
tataacgaactatttaaagatgtacccgtggttggtgattttgatccttccccttactca
ccctatgctcatcaacctattcaactaaaagcgggagaaacactctatttatttataaga
cctgacgatgcggttactaccattatcctgcaactcattgacgcgattaaccgcactccc
aatacaaaacttaaccttctgtttctggacatggacaataacaccatacaactgtgggcg
aatcgacatcaaatccccattcaattagtgaccagtcagcaaatcacgttaacccctggc
aaccaacaatttgaaggcttaacgcttgccaagaaacaaaccccattgctgttaatagcc
aatggtaaaacctcgcaagtcgtcgatttagggagattttaa

DBGET integrated database retrieval system