KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg1473Help
Entry
lpg1473           CDS       T00199                                 

Gene name
bioF
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00780  Biotin metabolism
lpn01100  Metabolic pathways
Module
lpn_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    lpg1473 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpn01007]
    lpg1473 (bioF)
Enzymes [BR:lpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     lpg1473 (bioF)
Amino acid related enzymes [BR:lpn01007]
 Aminotransferase (transaminase)
  Class II
   lpg1473 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19833038
NCBI-ProteinID: YP_095502
Pasteur: lpg1473
UniProt: Q5ZVG7
Position
1627065..1628210
Genome map
AA seq 381 aa AA seqDB search
MTLNIKINEYTAQLQEQGLLRTRQILETDKIDYIRFDSNDYLSLIEDRRIAEAYQKGYEL
YPCGSGASMVLSGYHSSHQTLERAFAEMLGVDDCLLFSSGYCANLAITALLGRLGTHCFI
DKSVHASIYDGLALSRVTYSRYIHNDMNALSALLKSHLGDSVLITEGIFSMSGQIAPLST
INTLCKENGSELFVDEAHAFGVIGPQGMGSVPGHGLTQNEVPLRVIPFGKAFASQGAVVG
GRKDWINALLQTARSFVYSTAISPALCYGLLKTLEIIAAADSRRAKLNQLVAQFKELIKS
SPLNWLDSDTPIQQLRLGCPHKALHYASELKKDGIYCSAIRAPTVNSASSGLRIIINYKH
TIEQIIELFNKLHLIHEYSSR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaatataaaaattaatgagtatacagcacagctgcaagaacaaggattattg
cgtacaagacaaattttagaaacggataagatagattatattcgatttgattctaatgat
tatttgtcgctcatagaagataggcgaattgcagaagcctatcaaaagggatatgagttg
tatccttgtggaagtggtgcttcgatggttttaagtggctaccatagtagccaccaaacc
cttgagagggcctttgccgaaatgctgggagtagatgattgtcttttattttcctctggg
tactgtgcaaatttggccattacggccttgcttgggcgtttgggaacacattgttttata
gataaaagcgttcatgcatcaatttatgatggattggctttgtcacgagtaacctactct
cgttacatacataatgacatgaatgctttgtctgccttgttaaaatctcatttgggcgat
tctgttttgattacagaaggtatttttagtatgagtgggcagatagcgccgttatcaacg
attaatacgttatgcaaagagaatggctctgagctctttgtagatgaagcgcatgctttt
ggtgtgattggaccgcaaggaatgggctctgtgccaggccatgggctgacacagaatgaa
gttcccttgcgagttattccttttggtaaggcatttgcttcccagggcgctgtggttggt
gggcggaaagattggataaatgctttgttgcaaacggcacgttcttttgtttattcaact
gctattagtcctgctttatgctatggtttgctcaagacattggagataatagcagctgcc
gactccagaagagcaaaattaaaccaattagttgctcaatttaaagaattaataaagtct
tcgcccttaaattggctggattcagatactccaattcagcaattaaggttaggatgccct
cataaggcactgcattatgccagtgaactgaaaaaagatgggatttattgctctgctatc
agagctccaacggtaaatagtgcttcttctggtttacggattattattaattataagcat
actattgaacaaatcattgagttatttaataaattgcacttaatacatgaatattcatct
cgataa

DBGET integrated database retrieval system