KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg1825Help
Entry
lpg1825           CDS       T00199                                 

Gene name
atoB
Definition
(RefSeq) acyl CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00071  Fatty acid degradation
lpn00072  Synthesis and degradation of ketone bodies
lpn00280  Valine, leucine and isoleucine degradation
lpn00310  Lysine degradation
lpn00362  Benzoate degradation
lpn00380  Tryptophan metabolism
lpn00620  Pyruvate metabolism
lpn00630  Glyoxylate and dicarboxylate metabolism
lpn00640  Propanoate metabolism
lpn00650  Butanoate metabolism
lpn00900  Terpenoid backbone biosynthesis
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01120  Microbial metabolism in diverse environments
lpn01130  Biosynthesis of antibiotics
lpn01200  Carbon metabolism
lpn01212  Fatty acid metabolism
lpn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    lpg1825 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    lpg1825 (atoB)
   00640 Propanoate metabolism
    lpg1825 (atoB)
   00650 Butanoate metabolism
    lpg1825 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    lpg1825 (atoB)
   00072 Synthesis and degradation of ketone bodies
    lpg1825 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpg1825 (atoB)
   00310 Lysine degradation
    lpg1825 (atoB)
   00380 Tryptophan metabolism
    lpg1825 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lpg1825 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lpg1825 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    lpg1825 (atoB)
Enzymes [BR:lpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lpg1825 (atoB)
Exosome [BR:lpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpg1825 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 19833391
NCBI-ProteinID: YP_095851
Pasteur: lpg1825
UniProt: Q5ZUH3
Position
2043750..2044934
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgctcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacac
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaatccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcaggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system