KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg1893
Entry
lpg1893           CDS       T00199                                 

Name
(GenBank) major facilitator family transporter
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Motif
Pfam: MFS_1 MFS_2 Sugar_tr
Other DBs
NCBI-ProteinID: AAU27963
Pasteur: lpg1893
UniProt: Q5ZUB4
Position
complement(2110585..2111865)
AA seq 426 aa
MNTLSFKHPLLAKTYLWIIWTIAACFFFYKYLIQVSPSVMTADLMKAFQVNAAGLGNLSA
FYFYSYLFMQIPVGVMLDRYSPRLLTTLAIFVCSISTYIFSQTNTLWLACLSRALMGAGA
AFAAVSCFKLAAVWFSPKRFALVSGMFMTAAMLGAVGGQMPLAFLVQHEGWRKALELVSV
MGIILGVVYFLILRDKPAQTQPMPNSKEPVIQLLRRIIVNKQAWALSLYSGLAFAPVSVF
GGLWGVPFLEKAYLLSRTDAALAISFIFVGFAAGAPFWGWFSDFIRRRKPVLFTGTCSAL
LCLLVVIYSSNQNLLTLIILLFLFGFGASGFFTSFAMIRELFPLVLVATVLGIMNTFNSV
FEALFEPLVGALLDWTWEGTMVDGIHQFTLHGYYFSLLLLPLSLILALLTLLLIDETYCR
TKEEVE
NT seq 1281 nt   +upstreamnt  +downstreamnt
gtgaacacattgtcattcaagcatccattgctggctaaaacttatctttggattatctgg
accatcgcggcatgttttttcttttataaatatttgattcaggtttctcccagtgtcatg
acagctgacttgatgaaggcatttcaggttaatgctgctggccttgggaatttgtcagct
ttttatttttattcctatttatttatgcagattcctgtgggcgttatgttagacaggtac
agcccaagattgctaacaactcttgctatttttgtctgcagtatcagtacttatattttt
tctcaaaccaatactttatggttggcctgtttaagtcgagcattgatgggggcgggagct
gcttttgctgccgtgtcttgttttaagctagccgctgtctggttttctccaaaacgattt
gctctagtatcagggatgtttatgacagcagctatgctgggtgctgtgggagggcagatg
cctttggcatttttggttcaacatgaaggttggcgcaaggcgcttgaattagtaagcgtg
atggggattatcctgggggtcgtgtattttctcattttaagagataagcctgcacaaacg
cagcctatgccaaatagcaaggaacctgttattcaattgttaagacgtattatcgttaat
aagcaggcctgggctttgtctttatatagtggattagcatttgctcctgtttcggttttt
ggtggattatggggagttccttttttggaaaaggcctatctcttatctcgtactgatgca
gcccttgcgatttcatttatttttgtcggttttgcggcaggcgcgccattttggggatgg
ttttctgattttatcaggcggagaaagcctgttttgtttacaggaacgtgttctgctcta
ttgtgtttattggtagttatttatagctcaaaccaaaatttgcttactttaattattctt
ttatttctctttggttttggagcgagtggattttttaccagctttgcaatgatcagggaa
ttatttcctttggtacttgtagcgacagtacttggtattatgaatacgtttaattcggtg
tttgaggctttgtttgagccactggttggtgctttgctggattggacatgggaggggacc
atggtggatggtattcatcaatttactttacacgggtactatttttctcttttattgttg
cctctgtctttaattttagccttattgaccttgttattgattgatgaaacatattgtcga
acaaaggaggaggtagagtaa

DBGET integrated database retrieval system