KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2081
Entry
lpg2081           CDS       T00199                                 
Symbol
traF
Name
(GenBank) sex pilus assembly TraF, thiol-disulfide isomerase and thioredoxins
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB
Motif
Pfam: TraF Thioredoxin_8 Thioredoxin Thioredoxin_2 AhpC-TSA DSBA Redoxin Thioredoxin_4
Other DBs
NCBI-ProteinID: AAU28147
Pasteur: lpg2081
UniProt: Q5ZTT0
Position
complement(2331707..2332129)
AA seq 140 aa
MRNKLAIFLILGTLFSSSLYADIDNAPLHALAKHQGFFFFFSSSCPHCQRFAPTLKRLSQ
HYGFSVVAISVDGGFLPSFPDAVMNEGQTKVFQVSVYPSLFLINPKSQVASLVTEGTIDE
GELTNRLLKISQIHDKEVPL
NT seq 423 nt   +upstreamnt  +downstreamnt
atgcgcaataaattagctatttttctaatattaggaacgttattttcatcaagcctatac
gccgatattgataatgcaccgcttcatgcccttgccaaacatcaaggatttttctttttt
ttcagttcgagttgtcctcattgtcaacgctttgcacccacgctcaaacgcttgagtcaa
cactatggctttagcgtagttgctatttctgttgatggaggctttttaccatcctttcct
gatgcggtgatgaatgaaggacaaacgaaggtatttcaagtcagtgtttatccttctctt
tttttgattaacccaaagagccaagtggcgagtcttgttactgaaggcactattgatgaa
ggcgaactaaccaatcggttactaaaaattagccagatacatgacaaagaggtgccttta
tga

DBGET integrated database retrieval system