KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2082Help
Entry
lpg2082           CDS       T00199                                 

Gene name
traF
Definition
(RefSeq) pilus assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg2082 (traF)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   lpg2082 (traF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF
Motif
Other DBs
NCBI-GeneID: 19833648
NCBI-ProteinID: YP_096095
Pasteur: lpg2082
UniProt: Q5ZTS9
Position
complement(2332119..2332901)
Genome map
AA seq 260 aa AA seqDB search
MARWFFVLLVSVSPFLYAEQPYLNEHEEGWYWHKDPKEEVKNKPQTESVAPSHVSKPADP
DKTWKLIGNRVQQARAQAILNPTPENIARARRLQRLIVAQANLFSEKWMLDLLINPDQDE
SLINPSSSAARDIYNQQNSMQKEKAITQISQTSGLLYFYEGGEPFSERMAQVVSDFANSY
HMTVIPIAMTNRISPMLPNSRVDSGQATQMGVKHIPAVFALNPVSKKTMPVAYGLVSQSE
LKENILMASNAFQSGDYNAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctagatggttttttgttttgttggttagcgtgagtccttttttgtacgccgagcag
ccttatcttaatgagcatgaggaaggttggtattggcataaggatcccaaagaggaagtc
aagaataaaccacaaaccgagtcagtggcaccttcacatgtaagtaaacctgccgatcct
gataaaacatggaaattgattggtaatagagtgcaacaggctcgcgcacaagctatttta
aatccaactcctgaaaatattgctcgtgcaagacgattacaacgattgattgtggcacag
gctaatctgttttctgagaaatggatgctcgatctgctaataaaccccgatcaggatgaa
agtcttattaatccgagcagtagtgcagcacgtgatatctacaaccagcaaaacagcatg
caaaaggaaaaggcgattactcaaattagtcaaacatctggtttgttgtatttctatgaa
ggtggtgaaccatttagcgagcgcatggcccaagtagtgagtgattttgcgaacagttat
cacatgactgttattccaattgccatgaccaatcgcatctccccgatgttacctaactca
cgagttgattccggtcaggcaactcagatgggtgttaaacacattcctgcggtttttgct
cttaatccagtatctaaaaaaaccatgccagttgcttatggcttagtcagccagtcggaa
ttgaaggaaaacattttaatggcaagcaacgcttttcaatcgggagattacaatgcgcaa
taa

DBGET integrated database retrieval system