KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2088
Entry
lpg2088           CDS       T00199                                 

Gene name
traV
Definition
(RefSeq) conjugative transfer: assembly
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg2088 (traV)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   lpg2088 (traV)
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-GeneID: 19833654
NCBI-ProteinID: YP_096101
Pasteur: lpg2088
UniProt: Q5ZTS3
Position
complement(2339878..2340228)
AA seq 116 aa
MKILTTLLLLPCVVLTGCAKLNEDFDCPAPNGGTCKRMDQVYDMVNGKGKSLAVTPSRNP
LVMDGRPGQPVRYGEGVMPLWIAPYEDTDGNYHQANRVYSVVKEGQWMQQSQLALK
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaaaattttaactactttattactgttgccctgtgttgttttgaccggttgcgccaaa
ttgaatgaggactttgattgcccagctcccaatggaggaacgtgcaaacgtatggatcag
gtttatgacatggtgaatggtaagggcaaatccctggctgtaacccccagccgaaatcct
ttggtgatggatgggcgacctggtcagcctgtgcgttatggagaaggggtgatgcctctt
tggatagcaccttatgaagacactgatggcaattatcatcaagccaatcgagtgtacagc
gttgttaaggaaggacagtggatgcagcagtcacaattggctttaaaataa

DBGET integrated database retrieval system