KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2464Help
Entry
lpg2464           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
  KO
K15480  effector protein DrrA/SidM
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    lpg2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DrrA_P4M NTP_transf_2 COMPASS-Shg1 Polbeta GlnD_UR_UTase Suv3_N AHD
Motif
Other DBs
NCBI-GeneID: 19834029
NCBI-ProteinID: YP_096471
Pasteur: lpg2464
UniProt: Q5ZSQ3
Structure
PDB: 

Position
complement(2777324..2779267)
Genome map
AA seq 647 aa AA seqDB search
MSIMGRIKMSVNEEQFGSLYSDERDKPLLSPTAQKKFEEYQNKLANLSKIIRENEGNEVS
PWQEWENGLRQIYKEMIYDAFDALGVEMPKDMEVHFAGSLAKAQATEYSDLDAFVIVKND
EDIKKVKPVFDALNNLCQRIFTASNQIYPDPIGINPSRLIGTPDDLFGMLKDGMVADVEA
TAMSILTSKPVLPRYELGEELRDKIKQEPSFSNMVSAKKFYNKAIKDFTAPKEGAEVVSV
KTHIMRPIDFMLMGLREEFNLYSEDGAHLSAPGTIRLLREKNLLPEEQIARIESVYNQAM
SKRFELHAEHKKEHDEMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSML
EKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAA
ATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVAD
PTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEG
REHRYTASTENFKNVKEKYQQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDE
YRILAKGQGLTTQLLGLKTSSVSSFEKMVEETRESIKSQERQTIKIK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagcataatggggagaattaaaatgagtgttaatgaagagcaatttggtagtttatac
agtgatgagcgagacaaaccattactatccccaaccgctcagaaaaaatttgaagaatat
cagaacaaattggctaatctaagtaaaataattcgagaaaatgagggcaatgaagtatct
ccatggcaggagtgggagaatggattacgtcaaatttacaaagaaatgatttatgatgcc
tttgacgcgcttggtgtcgagatgccgaaagatatggaagtccattttgcaggttctctt
gccaaggcacaagccactgagtatagtgatttggatgcctttgttattgttaaaaatgac
gaagatataaaaaaagtaaaaccggtctttgacgcattaaataatttatgtcagcgtatt
tttactgcaagcaatcagatatatcctgatcctattggaatcaatccaagccgtcttatt
ggtacgcctgatgatttgtttggtatgttaaaagacgggatggtagctgatgttgaagca
actgcaatgtcaattttaacatcaaaacctgttctacctcgctatgaattaggagaagag
ttacgagataaaatcaaacaagaaccttctttcagcaatatggtttcagccaagaagttt
tataataaagcaattaaagactttactgcacctaaagagggtgcagaagtagtgagtgtc
aaaactcatattatgcgtcccatcgattttatgctgatgggattgcgtgaggaatttaat
ttatacagtgaggatggagctcatctttcggcaccaggaactatacgtttattacgtgaa
aaaaatttattgcccgaagagcaaattgctcgaatcgagtcagtatacaatcaagcgatg
agcaagagatttgagttgcatgctgagcacaaaaaagaacatgatgagatgccttattct
gatgctaaagcaatgcttgatgaggtagcgaaaataagagagctgggtgttcaacgtgtc
acaaggattgaaaatctggaaaatgccaagaagttgtgggacaacgcgaatagcatgctt
gaaaagggtaacatcagcggatatcttaaagcagcgaatgagcttcataaatttatgaag
gaaaaaaatcttaaggaagatgatttaaggccagagttgagtgataaaacaatatctcca
aaaggatatgctattttacaatctttatggggagcagcttcggattatagtagagcggct
gcaactctcacagaatcaacggtagagcctggtttagtatcagctgttaacaaaatgtca
gcattctttatggattgtaaattaagtccaaatgagcgagcaacccctgatccagatttt
aaggttgggaaatctaaaattttagtaggtataatgcaattcataaaagatgtagcagac
ccaacttcgaaaatatggatgcataatacaaaagctttgatgaatcataaaattgctgct
attcaaaaacttgagagaagcaataatgttaatgatgaaacattagagagtgtgctgagc
tctaaaggtgaaaatttatccgaatatctttcttataaatacgcaacaaaagatgaagga
agagagcaccgctatacggcaagcacggaaaactttaaaaatgttaaagaaaaatatcag
caaatgcgaggtgatgctttaaaaacagaaatcctggctgatttcaaggataaactggct
gaagctaccgatgaacagagccttaagcaaattgttgctgaattgaaaagtaaagatgaa
tatagaattttggctaaggggcaagggttaacaacccagcttttagggttaaagacaagt
tcagtgtcttcatttgagaaaatggttgaggaaacaagagaaagtattaagtctcaagaa
agacaaaccattaagataaaataa

DBGET integrated database retrieval system