KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2679Help
Entry
lpg2679           CDS       T00199                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 19834244
NCBI-ProteinID: YP_096684
Pasteur: lpg2679
UniProt: Q5ZS40
Position
complement(3026515..3027459)
Genome map
AA seq 314 aa AA seqDB search
MKPFVYLTNQFLEPIIPMLIPDWNIIHGWKMASRVDQSRVVALATTVWDQIDHSFLMQFP
NLKIISHLGIGTDNIDINFLKQNHIILHSQPNAGVHDTAELAIALLLTLSRRVILNDRYT
RNNEWVEKKPRFLGNHLLGKQLGLVGFGQIGEKIAQFAEPFGLKIAYTARSQKNSPYLYC
PTAANLASISDFLIICCSGGIDTQHLINKQVLDNLGPEGYLINVARGSIVDQNALIDALQ
RHTIAGAALDVYQYEPEVPFALRQLDNVVLSPHMGSSTKENLNQMFQLQAKHLNQYLNES
LWQRESHVTLFEEQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagccatttgtttacctgaccaaccaatttctagagccaattattcccatgctgatt
cctgattggaacattattcatggttggaaaatggcttcacgagtggatcaatcccgggtt
gtggctttagccacaacggtatgggatcagattgaccattcgtttttaatgcaatttcct
aacttgaaaattattagtcacctgggaataggaacggacaatattgatattaatttttta
aagcaaaatcatattattctgcattcacaacctaatgcaggtgttcatgacacagcagaa
cttgctatcgctttattgttaacactgtcgcgaagggtgattctaaatgatcgctatacc
cgaaataatgaatgggttgagaaaaagccccgttttctaggcaaccatttattgggaaag
caattgggcttggttggattcggtcaaattggtgaaaagatagcgcaatttgcagagcct
ttcgggctaaaaattgcttatacggcccgaagtcaaaaaaatagcccttacttgtattgt
ccaacagccgcaaatttagcatctattagtgattttttaatcatttgttgttccggcggt
attgatacacaacatttaattaacaaacaggttttagataatttagggccagagggatat
ttgattaatgttgcgcgaggcagtatagtggatcaaaacgctctgattgatgctttgcaa
cgccatacaatcgctggtgccgctttggacgtataccagtatgaaccggaagttcctttc
gctttaaggcaacttgataacgtcgtcttatcaccacatatgggtagctcaactaaagaa
aatttaaaccagatgtttcaattacaggcaaaacatttaaaccaatatttaaatgagtct
ttgtggcaaagggaaagccatgtaactctttttgaagaacaataa

DBGET integrated database retrieval system