KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2687
Entry
lpg2687           CDS       T00199                                 
Symbol
icmV
Name
(GenBank) IcmV
  KO
K12223  intracellular multiplication protein IcmV
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg2687 (icmV)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg2687 (icmV)
SSDB
Motif
Pfam: DUF6391 TRP Steroid_dh DUF2207 Phage_holin_3_6
Other DBs
NCBI-ProteinID: AAU28745
Pasteur: lpg2687
UniProt: Q5ZS32
Position
complement(3037576..3038031)
AA seq 151 aa
MKKKSGSRIVRVFTRIINVRKWFDWDRMKSLTLYLVNGIKRLFIPQEPTHIESFDEAARK
LKLSEADLVIKQKALFRLSIIMVVAAFMILIYTGYQFLYGSWKATIISLVVVMIALVLAF
RYHFWYYQIKQRKLGCTVKEWYRQGLLGEKE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaaaagaaatcaggatcaaggatcgtaagagtttttacaaggattatcaatgttcgt
aaatggttcgattgggacagaatgaagtcactcaccttgtatttggtgaatggcattaaa
cggttattcatacctcaggaaccaacccatatcgaatcatttgatgaagcagccaggaaa
ttaaaattgagtgaggctgacttggtaatcaaacaaaaagccttgttcagactaagcata
attatggttgtcgctgcttttatgatacttatttatacgggttatcaatttttatatggt
tcatggaaagctacaataataagcttggttgtggttatgatcgcattggtactagccttt
cgttatcatttttggtactaccaaattaaacaacgtaaattgggatgtactgttaaagaa
tggtacaggcaagggttattgggtgagaaagaatga

DBGET integrated database retrieval system