KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2689
Entry
lpg2689           CDS       T00199                                 
Symbol
icmX
Name
(GenBank) IcmX (IcmY)
  KO
K12225  intracellular multiplication protein IcmX
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg2689 (icmX)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg2689 (icmX)
SSDB
Other DBs
NCBI-ProteinID: AAU28747
Pasteur: lpg2689
UniProt: Q5ZS30
Position
3038599..3039999
AA seq 466 aa
MKVLPKLALANLVCFTTLSVFAQPADPSGQQTSTNTSNLVTYLTNLGKYLGYDITQSSKA
PNPPYSQLFNSNVVQLVQNYAYNTFLGAIPVDAMSQSLMNFVTDKVQGNSLINNLANTTF
KYQNFSAPSSGADGKITANGLIDQSTASAQTPTTPGIFSAPQITTSGTYLNDPVSQAVFN
ILGTPDYSFCMDNEQKNWLPNCNLMYQNLVMQNVIGTLPPAQTSGSTPAFYSYKYNQPLI
SQLNSNSLIAPLLMDTSASQSGQDSGLTAKSQAQQALNFIRYASAQVTPPSLPKLSAYSE
LWNQATAKPNSAGYNEVQQKQAAATLSSYFNNLRVYAAQTSVGVSNLYYILSKRLPQNMS
ADQSNANITSQALNEFNMATRRLFDPTASNTPGQPNQQWIKQINDASPATVQKEIAILLA
EINYQMYLDRQIQERILLTNSIMLLQNLKAAQPTADFSSQGSPSEQ
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaaagtattacctaaactggccttggccaatctggtttgttttaccactttatctgtt
tttgctcaacctgctgacccatctggacaacagacaagcaccaacacctccaatctggtg
acctacctgacgaacctgggaaaatatttaggctatgatatcactcaatccagcaaagcc
cctaacccgccttattcgcaattattcaattccaatgtagttcaactcgttcaaaattac
gcctataatacctttttgggcgctattcctgtcgatgccatgtcgcagagcttaatgaat
tttgttaccgataaggtacaaggaaattcattaattaataatttggcaaatactactttt
aaatatcaaaatttcagcgccccatcctccggcgcagatgggaaaattacagcgaacggc
ttaatagatcaatcaacagctagtgcccaaacacccacaacacctggcattttttcagcg
cctcaaatcacaacctccgggacatacttaaatgacccagtcagtcaggcagtattcaat
attctgggcaccccggattacagtttttgtatggacaatgaacaaaagaactggttaccc
aattgtaacctcatgtatcaaaatctggtcatgcaaaatgtaattggcactttgccgcca
gcacaaacctctggttcaacgcctgctttttattcctacaaatacaatcaaccgcttata
agtcaactgaacagtaactctttgattgcccccttactgatggatacctctgcgtcacaa
tctgggcaagattctggattaacggcaaaaagccaagcccagcaagcgcttaattttatc
agatacgcaagcgctcaagtcacccctccttccttacccaagttgagtgcatacagtgag
ttatggaatcaagccactgcaaaacccaattctgcaggctataatgaagtccaacaaaaa
caagcagccgcaacattaagcagttattttaataatttgcgtgtttatgcagcgcaaact
tctgttggcgtgagcaacctctactatattttatccaaaaggttacctcaaaatatgagt
gcagaccaaagtaacgctaatatcacaagccaagcgctgaatgaatttaacatggctact
cgacgattatttgatcctaccgcctccaacactcctggacaaccaaaccaacaatggatt
aaacaaattaatgacgcatcccctgctacagttcaaaaagaaatagcgatattgctggct
gaaattaattatcaaatgtatttggacagacaaatacaagaacgaatattattaaccaat
agcattatgctattgcaaaatttaaaagccgctcaacccactgctgatttttcaagtcaa
ggctctccttctgagcaataa

DBGET integrated database retrieval system