KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg2965Help
Entry
lpg2965           CDS       T00199                                 

Definition
(RefSeq) AhpC/Tsa family peroxynitrite reductase
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
Enzymes [BR:lpn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     lpg2965
Exosome [BR:lpn04147]
 Exosomal proteins
  Proteins found in most exosomes
   lpg2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 19834530
NCBI-ProteinID: YP_096958
Pasteur: lpg2965
UniProt: Q5ZRB7
Position
complement(3354883..3355488)
Genome map
AA seq 201 aa AA seqDB search
MSVLVGRKAPDFTVAAVMGNGEIVDKFNLHEHLKGKYGLVFFYPLDFTFVCPSELIALDH
RIEEFKRRNVEVVAVSIDSHFTHNAYRNTPVKNGGIGPVRFTLAADMTHSICQSYGVEHP
VAGVAFRGAFVIDTNGMVRSQIVNDLPIGRNIDEILRIIDAVQFFEENGEVCPAGWQKGQ
AGMKASPKGVAEYLSEHSESL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttagttgggcgtaaagcacctgattttactgtggctgcagtaatgggcaat
ggggaaattgttgataaattcaatttacacgaacatttgaaaggcaaatacggattagtt
ttcttttatcccctggattttacctttgtatgcccttccgagttaattgctcttgatcac
cgtattgaagaattcaaaagacgtaatgttgaggtggttgctgtatctattgattcacat
tttacccataatgcgtataggaatacgcctgtgaaaaatggcggaatagggcctgtgaga
tttactttggcagctgacatgactcacagtatttgccaatcctatggcgtagagcatcca
gttgctggcgtggctttccgaggcgcttttgttattgatacgaatggcatggtccgttca
caaatcgtcaatgacttgccgataggtagaaatattgatgagattcttcgtatcatagat
gcagttcaattctttgaagaaaatggtgaggtgtgtcctgctggctggcaaaaaggacaa
gctggcatgaaagcatctcctaaaggtgttgcagaatatttgtctgagcattccgagtcc
ttgtaa

DBGET integrated database retrieval system