KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_0125Help
Entry
LPO_0125          CDS       T02175                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase, tetrahydrofolate-dependent, subunit (T protein) of glycine cleavage complex
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00260  Glycine, serine and threonine metabolism
lpo00630  Glyoxylate and dicarboxylate metabolism
lpo00670  One carbon pool by folate
lpo01100  Metabolic pathways
lpo01110  Biosynthesis of secondary metabolites
lpo01130  Biosynthesis of antibiotics
lpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LPO_0125 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LPO_0125 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LPO_0125 (gcvT)
Enzymes [BR:lpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     LPO_0125 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: CCD04260
Position
complement(132145..133227)
Genome map
AA seq 360 aa AA seqDB search
MTAKTPLHTTHLACGAKMVDFHGWDMPLHYGSQLNEHHAVRNDAGMFDVSHMTIVDILGA
GGRQFLRKLLTNDVDQITHNGKALYSCMCNEHGGIIDDLIVYQRASDNYRVVLNSATRQN
DVAWIRAKSEGFAVGLQERRELSMLAVQGPNAIAKTLSILAPAHVDAVSTLTSFECVDVD
HWFFARTGYTGEDGLEIIVPNEFVTQLWNDLLNAGVTPCGLGARDTLRLEAGMLLYGQDM
DETTTPLESGLAWTVKWEPEDRGFIGMGALASQKQQGIKRKMVGLTLLDKGIMRHGQKVI
IEGCPDGIITSGSYSPTLQQSIALARVPMETGEQVLVDIRGKLIPAKVGKPRFIKQGKPV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaaaactcctcttcacactacgcacttagcatgtggtgccaaaatggtggat
ttccatggttgggatatgcctcttcattatggatctcagttaaacgaacatcatgctgtc
agaaacgatgctggcatgtttgatgtctcacatatgaccatcgttgatattttaggcgcc
ggtggccgtcaatttctgcgtaaactgctaactaacgatgtcgatcaaattactcataat
ggaaaagccctatacagctgtatgtgtaatgaacacggcggaattatagatgacctgatt
gtatatcaacgcgcttccgataattaccgagtggtacttaattcggcaaccaggcaaaat
gatgtggcctggattcgcgcaaaaagtgaaggatttgctgttggcttacaagaaaggcgc
gaattatcaatgctcgctgtacaaggtccaaatgccatagcgaaaacattgagtattctt
gcacccgcccatgtagatgccgtttcaactcttacctctttcgaatgcgttgatgtggat
cactggttttttgctcgcaccggctatacgggggaagatggccttgaaatcattgtccct
aatgaatttgttacccaactctggaatgatctcctgaatgctggagtaacgccatgtgga
ttaggggctagagataccctgagattagaagcaggaatgcttctttacggccaggatatg
gatgaaacaacaaccccactggaatctggtttggcctggacagtaaagtgggaaccggaa
gatagaggatttatcggaatgggcgctttggcttcgcaaaagcaacaaggaattaaacga
aagatggtcggtttaaccttgttggacaaaggaattatgcgtcatggccaaaaggttatt
attgaaggctgccccgatggaattatcacaagcggcagttattctcctaccctgcaacaa
tctatagctttggcacgagttcccatggaaacaggggaacaagtacttgttgacatacgc
ggaaagttaatcccggcaaaagtagggaagcctcgctttatcaaacaaggaaaacctgtt
taa

DBGET integrated database retrieval system