KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_0680Help
Entry
LPO_0680          CDS       T02175                                 

Definition
(GenBank) putative methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lpo03009]
    LPO_0680
Enzymes [BR:lpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     LPO_0680
Ribosome biogenesis [BR:lpo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LPO_0680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ TehB Methyltransf_25 PITH Methyltr_RsmB-F Methyltransf_23 NUMOD1
Motif
Other DBs
NCBI-ProteinID: CCD04768
Position
complement(663710..664624)
Genome map
AA seq 304 aa AA seqDB search
MELPNHFSTVYVSKPEFIETLCEELGEVSNKIGSLVFSPHQKLDVCFALDVWLEPEIVTF
QSISEAAKILRQAGKFWYLHPATEIRRSRLIEEQLRKCPSLMSHFPVASDIPPIGVFSLL
DRNTLLFSAKRLKKWPDGQCYFIEDKVNPPNRAYLKLWEALFLLNKYPLPGETVLDLGAS
PGGWTYVMQSLGTQVTSVDKAELDTKIMALPRVSFLKQSAFALDPEQLTESYDWVLSDVA
CYPDRAYTLIKKWIASKKAKQLIFTIKLQGQTDLNTIKRFQSIPNSKVINLFYNKHEVTF
FYPV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcccaatcatttctctactgtctatgtgtcaaaaccagagtttatagaaaca
ctttgtgaggagttaggcgaggtatccaataaaataggctctctcgttttttctcctcat
cagaagcttgatgtttgttttgcactggatgtatggcttgaacctgagatagtaaccttt
caatccatttcagaagcagcaaaaatattgaggcaagccggaaaattctggtatttgcac
cccgctactgaaattcgccgatcgcgcttgattgaggaacaacttcgcaagtgcccatca
ctaatgtcccattttccagttgcaagtgacattccacccataggtgtatttagtcttctt
gatagaaacactctactctttagcgccaaacgactaaaaaaatggccggatggacaatgt
tattttattgaagacaaagtcaatcccccaaaccgggcttatttaaaattatgggaagcc
ttgttcctgttaaataaataccctctccctggtgaaacagttttagatttgggcgcatcc
ccgggaggttggacatatgtgatgcaatcactcggaacccaagtcacttcggtcgacaaa
gcagaactggatacaaaaatcatggcgcttcccagagtcagttttttaaagcaaagcgcc
tttgccctagatcccgaacaactcacagagtcttatgactgggtactttccgatgttgcc
tgctatcctgacagagcctacaccctcatcaaaaaatggatagcatcaaaaaaagcaaaa
cagttgatttttaccatcaaactacagggacaaactgacttaaacacaatcaaacgattt
caatccatacctaattccaaagtaatcaatctgttttataacaaacatgaagtcacgttt
ttttatccagtataa

DBGET integrated database retrieval system