KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_1473Help
Entry
LPO_1473          CDS       T02175                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00780  Biotin metabolism
lpo01100  Metabolic pathways
Module
lpo_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LPO_1473 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpo01007]
    LPO_1473 (bioF)
Enzymes [BR:lpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     LPO_1473 (bioF)
Amino acid related enzymes [BR:lpo01007]
 Aminotransferase (transaminase)
  Class II
   LPO_1473 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CCD05507
Position
1510682..1511827
Genome map
AA seq 381 aa AA seqDB search
MTLNIKINEYTEQLQEQGLLRTRQILETDKIDYIRFDSNDYLSLTEDRRIAEAYQKGYEL
YPCGSGASMVLSGYHSSHQTLERAFAEMLGVDDCLLFSSGYCANLAITALLGRLGTHCFI
DKSVHASIYDGLALSRVTYSRYIHNDMNALSALLKSHLGDSVLITEGIFSMSGQIAPLST
ISTLCKENGSELFVDEAHAFGVIGPQGMGSVPGHGLTQNEVPLRVIPFGKAFASQGAVVG
GRKDWINALLQTARSFVYSTAISPALCYGLLKTLEIIAAADSRREKLNQLVAQFKELIKS
SPLNWLDSDTPIQQLRLGCPHKALHYASELKKDGIYCSAIRAPTVNSASSGLRIIINYKH
TIEQIIELFNKLHLIHEYSSR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgactcttaatataaaaattaatgagtatacagaacagctgcaagaacaaggattattg
cgtacaagacaaattttagaaacggataagatagattatattcgatttgactctaatgat
tatttgtcgctcacagaagataggcgaattgctgaagcctatcaaaagggatatgagttg
tatccttgtggaagtggtgcttcgatggttttaagtggctaccatagtagccaccaaacc
cttgagagggcctttgccgaaatgctgggagtagatgattgtcttttattttcctctggg
tactgtgcaaatttggccattacggccttgcttgggcgtttgggaacacattgttttata
gataaaagcgttcatgcatcaatttatgatggactggctttgtcacgagtaacctactct
cgttacatacataatgacatgaatgctttgtctgccttgttaaaatctcatttgggcgat
tctgttttgattacagaaggtatttttagtatgagtgggcagatagcgccgttatcaacg
attagtacgttatgcaaagagaatggctctgagctctttgtagatgaagcgcatgctttt
ggtgtgattggaccgcaaggaatgggctctgtgccaggccatgggctgacacagaatgaa
gttcccttgcgagtgattccttttggtaaggcatttgcttctcagggcgcagtggttggt
gggcggaaagattggataaatgctttgttgcaaacagcacgttcttttgtttattcaact
gctattagtcctgctttatgctatggtttgctcaaaacattggagataatagcagctgcc
gactccagaagagaaaaattaaaccaattagttgctcaattcaaagagttaataaagtct
tcgcccttaaattggctggattcagatactccaattcagcaattaaggttaggatgccct
cataaagcactgcattatgccagtgaactgaaaaaagatgggatttattgctctgctatc
agagctccaacggtaaatagtgcttcttccggtttgcggattattattaattataagcat
actattgaacaaatcattgagttatttaataaattgcacttaatacatgaatattcatct
cgataa

DBGET integrated database retrieval system