KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_1617Help
Entry
LPO_1617          CDS       T02175                                 

Gene name
yfcY
Definition
(GenBank) beta-ketoacyl-CoA thiolase, anaerobic, subunit
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00071  Fatty acid degradation
lpo00072  Synthesis and degradation of ketone bodies
lpo00280  Valine, leucine and isoleucine degradation
lpo00310  Lysine degradation
lpo00362  Benzoate degradation
lpo00380  Tryptophan metabolism
lpo00620  Pyruvate metabolism
lpo00630  Glyoxylate and dicarboxylate metabolism
lpo00640  Propanoate metabolism
lpo00650  Butanoate metabolism
lpo00900  Terpenoid backbone biosynthesis
lpo01100  Metabolic pathways
lpo01110  Biosynthesis of secondary metabolites
lpo01120  Microbial metabolism in diverse environments
lpo01130  Biosynthesis of antibiotics
lpo01200  Carbon metabolism
lpo01212  Fatty acid metabolism
lpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPO_1617 (yfcY)
   00630 Glyoxylate and dicarboxylate metabolism
    LPO_1617 (yfcY)
   00640 Propanoate metabolism
    LPO_1617 (yfcY)
   00650 Butanoate metabolism
    LPO_1617 (yfcY)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPO_1617 (yfcY)
   00072 Synthesis and degradation of ketone bodies
    LPO_1617 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPO_1617 (yfcY)
   00310 Lysine degradation
    LPO_1617 (yfcY)
   00380 Tryptophan metabolism
    LPO_1617 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPO_1617 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPO_1617 (yfcY)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LPO_1617 (yfcY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpo04147]
    LPO_1617 (yfcY)
Enzymes [BR:lpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LPO_1617 (yfcY)
Exosome [BR:lpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPO_1617 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCD05647
Position
complement(1657396..1658715)
Genome map
AA seq 439 aa AA seqDB search
MKHQSNLSGRNVYVVDGSRTPFLKAKGVGPFCGSDLAVAAGTTLLNRQPFSPDELDEVII
GSAMPGPDEANIARVVALRLGCGDKVPAFTVMRNCASGMQALDNAAIQIATGRSNLVLAG
GTDAMSHAPLLFNEKMASWLANWFAAKSMGQKLALITKFKPSYLAPVIALLRGLTDPIVG
LNMGQTAEKVAYRFNITREQMDEFAAQSHLRIAQAYAENRMSEVAPIIDYKGCIYPQDDG
IRADSTVEKLSKLKPFFDKKYGMVTPGNSSQITDGACLLLLASAEAVKKYALPVLGRIVD
SQWAALDPSQMGLGPVHAATPILERHNLKPQDLDCWEINEAFAAQVLGCLAAWNDEEYCK
TQLGLKEAMGSPSLERLNRDGGAIALGHPIGASGARIVLHVLKSLEQRNESRGMAAICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccagtcgaatttaagtggtcgtaacgtttatgttgtcgatggaagtcgaacg
ccttttcttaaagcaaaaggagtaggtccattctgtggttcagatttggcagttgctgca
ggaacaactttgctaaatcgtcaaccattttctccggacgagcttgatgaggtcattatt
ggtagcgctatgcctggaccagacgaggccaatattgctcgcgtggttgctctgcgtttg
ggatgtggtgataaggtgcctgcatttactgtaatgagaaattgtgcgtcaggcatgcag
gcattggataatgccgcaatccaaattgctacagggcgcagtaatttggtcctcgctggt
ggaacagatgccatgagtcatgcgccgttgttatttaatgaaaaaatggcttcctggctg
gcaaactggtttgcagctaaaagtatggggcaaaagctggctttaattacaaagtttaaa
ccttcttatctggcaccggtaatcgctttgctcagaggcctgactgatccgattgtagga
ttgaatatggggcaaacagctgagaaagtagcttatcgatttaacatcacaagagagcaa
atggatgaattcgcagctcaaagccatttaagaatagctcaagcttatgctgaaaataga
atgtctgaagttgccccaattatagattacaaaggttgtatatatcctcaagatgatggg
attagggcagattctacggtggaaaaattgtcaaaattaaaacctttttttgacaaaaaa
tatggcatggtcacccctggtaacagctcacagataactgatggtgcctgtttgttgcta
ttggccagcgctgaggctgtaaaaaaatatgctttaccggtattgggtcgaatagttgat
tcacaatgggctgctctagatccctctcaaatgggtttgggtcctgttcacgcggcaacc
cctatattagaaagacataatttaaagccacaagatttggattgttgggaaatcaatgag
gcctttgccgctcaagtcttagggtgtttggctgcatggaacgatgaagaatactgcaaa
acacagcttggtcttaaggaggcaatgggatcgccatcgctggagcggctcaatcgggat
ggaggagcaattgcgttaggtcatcctattggtgccagtggggctcgtattgtattgcac
gttcttaaatctctagagcaaagaaatgagtcgcgaggtatggcagcaatttgtatcgga
ggtggtcagggaggagctatgtatcttgaacgagttactgaggtgaaaggacatgaataa

DBGET integrated database retrieval system