KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_2064Help
Entry
LPO_2064          CDS       T02175                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00450  Selenocompound metabolism
lpo00970  Aminoacyl-tRNA biosynthesis
lpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LPO_2064
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LPO_2064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpo01007]
    LPO_2064
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpo03016]
    LPO_2064
Enzymes [BR:lpo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LPO_2064
Amino acid related enzymes [BR:lpo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LPO_2064
Transfer RNA biogenesis [BR:lpo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LPO_2064
 Prokaryotic type
   Other AARSs
    LPO_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 Anticodon_1 zf-B_box zf-HIT
Motif
Other DBs
NCBI-ProteinID: CCD06063
Position
2140907..2142466
Genome map
AA seq 519 aa AA seqDB search
MTNSKKYLLIPSIPTPNGRLHLGHIGGPFLSADILARYLRTRGHSAWVISGTDSFESYAA
GKAEEEHRSPEETCNYYHPLIEEDLRLMGIQMDLFINPLKAPWKYLYQHWHHNIYNQLIN
NGTTLVIKEKFPWDEDNQRYLSGYWLKGDCPICRKKTASYFCENCGTHFRPEELIQEDAF
NQKEVENIFLKLPNGINLSSKGVSKEIQAIFHNYLERQNQILRLTTFCDWGLADPNDKTR
TLFSYGFVFAYFLMIGEIAGQLIGINRNAFASDSDVITISSFGIDNSIPFLSSSIGISSA
CPQYKPFDYYLVNYFYYLDGNKFSTSRQHMIGVEDIITCKELSSDLVRLFLAAIDVRHQT
GDFLTDEFIYYYNQTVDWLEELVITGIQNIAPPTVCDHFFKDELNELLKTQEYALQPENY
LPHLAVNAINHWIIQGKQLNQDSKHYFWWLKGLSLVIYPFMPNLGQTIWGSLGYENSPRI
KDFFALPLHSIQKNVPINRNRISQELMFIKEEHDDEIIV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgactaatagcaaaaagtatttacttatcccctcaatcccgactcccaatggtcgcttg
catttaggtcatattggtggtcctttcttgagtgctgatattttagcaagatatttaagg
acacgcggacattcagcctgggttatttctggaacagatagctttgaatcctatgccgca
ggaaaagcagaagaagaacatcgtagtccggaagaaacatgcaattattaccatccatta
attgaagaggatttaagattaatgggtatccaaatggatctcttcattaatccgctaaaa
gcaccgtggaaatatctctaccagcactggcaccacaacatttacaatcagctaattaat
aatggaactactctagtcattaaagagaagtttccctgggatgaggacaatcaacggtat
ttatcgggttattggctcaaaggcgattgtccaatttgcaggaaaaaaacagccagttat
ttttgtgagaattgcgggacacattttcgccctgaagaactgattcaggaggacgctttt
aatcagaaagaagtagaaaatatttttttaaagctgccgaacggcatcaatttaagttcc
aaaggtgtcagcaaagagattcaagccattttccataactatttggaacgacaaaaccaa
atcttgagattaacaactttttgtgattggggtttggctgatcctaatgataagacaaga
acattatttagttatggttttgtatttgcctatttcttaatgattggagaaatcgctggt
caattaatcggtatcaatagaaatgcttttgcctccgattcagacgtaatcactatatcc
agttttggtatcgataattcaataccttttttaagtagctccataggtattagttctgct
tgtcctcaatacaagccctttgattattatcttgttaattatttttattatttggatggg
aacaaattttccactagtcggcaacatatgatcggagtagaggatattatcacctgcaag
gaactttcaagtgatcttgtccgacttttccttgctgcaattgacgtgcgccatcaaacc
ggcgactttctcaccgatgaatttatttattattataatcaaaccgttgactggcttgag
gaattggtcataacgggcatacaaaacatagctccaccaacagtttgtgatcattttttt
aaagatgagttaaatgaacttttgaagactcaagagtatgccttgcagcctgaaaattac
ttaccacatctcgcagtaaatgcaattaatcattggatcattcaaggaaaacaactgaat
caggactcaaagcactatttttggtggttaaaaggattaagtctggtgatttatcctttt
atgcctaatcttggacagactatttggggatccttagggtatgaaaactcaccaaggata
aaagatttttttgctctccccctgcattctatacaaaaaaatgtgccaataaatcgaaat
cgaatttctcaagaattaatgtttatcaaggaggagcatgatgatgaaatcattgtgtaa

DBGET integrated database retrieval system