KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_2155Help
Entry
LPO_2155          CDS       T02175                                 

Gene name
mvaA
Definition
(GenBank) hydroxymethylglutaryl CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00900  Terpenoid backbone biosynthesis
lpo01110  Biosynthesis of secondary metabolites
lpo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPO_2155 (mvaA)
Enzymes [BR:lpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LPO_2155 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CCD06150
Position
2229974..2231272
Genome map
AA seq 432 aa AA seqDB search
MSIAANAGELFRGFSKLSREERFQRLCALGALTHEDITFLKQGGIKDLNLADKLIENVIG
YFQLPLGVATNFNIDGRDYIIPLAVEETSIIAALSKSAKWIRQHGEINTWVHGECIIGQI
QLAKVKDFQRFSDLFNKNRQYFIEIANKDVAANMVKRGGGVTDLQVRHLKREDGQDMAVI
HLTMNSCDAMGANIINQVLEYLKQPIEQITGEEVTMCILSNLNDQKLTTAQVIIRNIDPI
LGQKLQEASLFAEIDPYRAATHNKGVMNGIDPVLIATGNDWRAVEAGIHAYAARSGQYKA
ITRWRYQNEILTGELTAPIIVGTVGGVTSLHPTAKMCLRMMDITSANQLSQVIAAVGLVQ
NLGALKALCTDGIIQGHMKLHIDNLLLVAGANEKEMPVLKEKLQEWLNLNKRVSLNNAYD
LLAEIRQAPVAV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagctgctaatgccggtgaattatttcgcggattctcaaagttatcacgtgaa
gagcgctttcaaaggttatgtgctttaggtgccttgactcatgaagacataacatttctt
aaacaaggcggtattaaagatttaaatctggccgacaaattgattgaaaatgtgattgga
tattttcagcttccattgggtgtggccactaattttaatattgatggacgtgattatata
atacctttggcagtggaagaaacctctattattgccgctctttccaaatcagcgaaatgg
attaggcagcatggtgaaatcaatacctgggttcacggtgaatgtattattgggcaaatt
caactggcaaaagtaaaggattttcaaagattctctgacctctttaataaaaatcgtcaa
tattttatagaaatagcgaataaagacgttgccgccaatatggtcaaacgaggcggcggt
gttaccgatttgcaagtacgccatttaaagagagaagatgggcaagatatggcagtaatt
catttgacgatgaacagctgcgatgctatgggtgccaatatcatcaatcaagtacttgaa
tatttaaaacaacccatagaacaaataactggtgaagaagtcaccatgtgtattttatcc
aatttaaacgatcaaaaattaacaaccgctcaagtcatcattcgtaatattgaccccatc
ctcggtcaaaaattgcaagaggcctcactctttgcagaaatagatccctatcgcgctgct
acccataataaaggggttatgaatggaattgatccggttttaattgctacagggaatgat
tggagagctgtggaagctggaatacacgcctatgcggcacgttcgggacaatacaaagcg
attactcgctggcggtatcaaaatgaaatactcacaggagagttaactgccccaatcata
gtaggtactgttggaggcgtaacctctttacaccccacggctaaaatgtgtttacgaatg
atggatatcacttctgccaatcaactctcccaggtaatcgcagcagttggactagtgcaa
aatcttggtgcactcaaagctttatgcactgacgggatcatccagggccatatgaaattg
catattgataatttgctattagttgcaggggctaatgaaaaagaaatgcccgtgctcaaa
gaaaaattgcaagaatggcttaacctgaacaaacgagtcagcttgaataacgcttatgac
ctattagctgaaatccgacaagctcctgttgcagtatga

DBGET integrated database retrieval system