KEGG   Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1): LPO_2925Help
Entry
LPO_2925          CDS       T02175                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine-4-hydroxylase (PAH) (Phe-4-monooxygenase)
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lpo  Legionella pneumophila subsp. pneumophila Lorraine (serogroup 1)
Pathway
lpo00360  Phenylalanine metabolism
lpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpo00790  Folate biosynthesis
lpo01100  Metabolic pathways
lpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LPO_2925 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LPO_2925 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LPO_2925 (phhA)
Enzymes [BR:lpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     LPO_2925 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: CCD06866
Structure
PDB: 

Position
complement(3051805..3052623)
Genome map
AA seq 272 aa AA seqDB search
MEFSSRYVAHVPDAQGLVDYSAQENRIWNILFERQLKLLPGRACDEFLSGLQTLGLNSSI
IPQLPEVSERLKAKTGWQVAPVAALISAREFFELLAEKYFPAATFIRSEEELDYVQEPDI
FHELFGHCPMLTDRVYAEFVHDYACKVLTFPEQDWPLLQRMFWFTVEFGLIKTPKGLRAY
GGGILSSISETVYCVESDIPVRILFDPVVAFRMPYRIDQLQPVYFVIDSYQNLYDFVLSD
MGKFMDRARELGELPPYFDVDPDNPNIHIRAC
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggagtttagtagccggtatgtcgcacatgtccctgatgctcagggtttagtcgattat
tcggcacaggaaaatagaatttggaatattttatttgagagacaacttaagttattgcca
ggaagagcttgtgatgaatttctgtctggattacagactttaggacttaactcctctatt
attccacaacttccagaagtaagtgagcgattaaaggccaaaacgggatggcaagtagcg
ccagttgctgctttaatttcagccagggagttttttgaattattagcagaaaaatatttt
cctgcggcgacttttattcgaagtgaagaagaattggattatgttcaagaacctgatatt
tttcatgagctttttggtcattgtcctatgttaaccgatagagtctatgctgaatttgtc
catgattacgcatgtaaggtattaacttttcctgagcaggattggcctttattgcaaaga
atgttttggtttactgtagagtttggattgattaaaacgcctaaagggcttagagcatac
ggcgggggaattttatcttctattagtgaaacggtatattgtgtggaaagtgatattcct
gtgcgaattttatttgatcctgtggtcgcttttcgaatgccttatcggattgaccagcta
caacctgtttatttcgttatcgacagctatcaaaatttatatgacttcgtgctttctgac
atgggtaaattcatggatcgtgcgcgagagttgggtgaacttccaccgtattttgatgtg
gatccggataacccaaatattcatataagggcttgttag

DBGET integrated database retrieval system