KEGG   Legionella pneumophila Paris (serogroup 1): lpp0486Help
Entry
lpp0486           CDS       T00209                                 

Gene name
glk
Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00010  Glycolysis / Gluconeogenesis
lpp00052  Galactose metabolism
lpp00500  Starch and sucrose metabolism
lpp00520  Amino sugar and nucleotide sugar metabolism
lpp00521  Streptomycin biosynthesis
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp0486 (glk)
   00052 Galactose metabolism
    lpp0486 (glk)
   00500 Starch and sucrose metabolism
    lpp0486 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    lpp0486 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lpp0486 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    lpp0486 (glk)
Enzymes [BR:lpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lpp0486 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CAH11634
Pasteur: lpp0486
Position
530135..531142
Genome map
AA seq 335 aa AA seqDB search
MNFFMMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFISLESALLTYKTR
HSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVMNDFTAIAMSLPV
LSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGEGGHADWGAKTEQE
WFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAAQIISLALNQECFIA
HKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQSDFRIQFEDKGRFSDF
NALIPTYVIAAAQPGILGASVSLKQILTGASHVLF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttttatgatgcctcatgatttagcgcagtatgcgattgttgcggacataggc
ggtacttttgctcgtttcagtagagttaatcttgtcaatttgcagatggataaaattgaa
atttctccttgtgccgagtttattagtttggagtccgcgctattaacttataaaacccgg
cattctttgcaagaaataaaacatattgcgatagcgattgcgtgtccagtcatcgatgat
ttggtttctatgacgaattgtcattggcaattttcaataacagagttaaaacagagactt
ggccttgaagttctggaagtcatgaatgattttactgcgattgcgatgagtttacctgta
ttatcgactcaggatctggtgcagattggtaatggttacctggatgccagtaaagtgaga
gtggtgttaggcgcaggaaccggtttgggtgttgcttatttaattcctcatcaacatcac
tatagtgcttttgcaggggaaggggggcatgctgattggggagcaaaaactgagcaggaa
tggtttatctatcgttatttaaaaagtaaatactcccatgtatcttatgagcgtttgctg
tctggtcaaggactggaaaatttatatcaagctttagccgcgtatcatagtaaaaaagtt
gaatttttgtcagcagcgcaaattatatctttggcattaaatcaggaatgtttcatagct
cataaggcagtagcccaatttttttcaagtttgggatcgtttgctggtgatttagcatta
acttatggagcttttggtggtgtttatattgcaggagggattatgccgcgtttgctctcc
ttggtacaccaaagcgactttagaatccaatttgaagacaaaggacgatttagtgatttt
aatgccttaattcccacttatgtcattgcagccgctcaaccaggtattttaggcgcgagc
gtcagtttaaaacaaatattgacaggagcttctcatgtccttttctga

DBGET integrated database retrieval system