KEGG   Legionella pneumophila Paris (serogroup 1): lpp0638Help
Entry
lpp0638           CDS       T00209                                 

Gene name
pyrB
Definition
(GenBank) hypothetical protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00240  Pyrimidine metabolism
lpp00250  Alanine, aspartate and glutamate metabolism
lpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lpp0638 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lpp0638 (pyrB)
Enzymes [BR:lpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     lpp0638 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Sigma70_r1_1 Hydrolase DUF3271
Motif
Other DBs
NCBI-ProteinID: CAH11786
Pasteur: lpp0638
UniProt: Q5X7G7
Position
688811..689704
Genome map
AA seq 297 aa AA seqDB search
MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYENSTRTRISFELAERH
LAMSVVNLDLQTSSEIKGEAIEDTIRTLAAMGIQYFVIRHKQDGLQQNLANKLGDTVHII
NAGDGTHAHPSQAILDMVTIIEQKKRLDKLKIAILGNIKHSRVANSFQCICSKLGVGDLV
LISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQRERLLEDDHLDLDFYRNNFALTQ
KSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVTNGVYARMAILESLIAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttcttgaaattagtcaattgtcatctgaacaaattgaatccttattgcaa
cgagctttatattttaaacatacaaagcaatacccttcttattcccaaagtattattgct
aatttattttatgaaaacagtacccgaactcgcatcagctttgagttagcagagcgccat
ctggcaatgtctgtagtaaatcttgatcttcagacctcatcagaaattaaaggcgaagcc
attgaagataccatcagaacgctagcagctatgggtatccagtattttgtaattcgccat
aagcaagatgggctgcagcaaaatttagctaataagttaggtgatacagttcatataata
aatgctggtgatggaactcatgctcatccaagccaagcaatactggatatggtgacaatt
attgaacaaaaaaagcgattagataaattaaaaattgctattttgggaaatattaaacat
tcacgtgttgctaattctttccaatgcatttgcagtaaactaggggttggtgacttggtt
ttaatttctccagagatttggcaaccatcacaagtgcactttggacgggttactgataat
ctcaatgaaggtctggaaggtgcggatgtggtaatttgcctgcgagttcaaagggaacgc
ttgctggaagatgatcatttggatttggatttttatagaaacaattttgcacttactcaa
aaaagtctgtcttatgcaaaacctgacgctatggttatgcaccctgggcctatgaatcgc
ggggttgaaattgatagtgaagtggctgatggcaaccaatcttgtattttacaacaggtt
actaacggtgtttatgcaagaatggctatccttgaatcgctgatagcgagttag

DBGET integrated database retrieval system