KEGG   Legionella pneumophila Paris (serogroup 1): lpp0755Help
Entry
lpp0755           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Brite
Enzymes [BR:lpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     lpp0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_11 Methyltransf_12 NodS Methyltransf_4 Methyltransf_23 Ubie_methyltran Methyltransf_18 MTS Methyltransf_PK GCD14 Methyltransf_2 CMAS Methyltransf_32 Methyltransf_3 PrmA
Motif
Other DBs
NCBI-ProteinID: CAH11903
Pasteur: lpp0755
Position
complement(847902..848552)
Genome map
AA seq 216 aa AA seqDB search
MNHSARINMIKQQLRTGDVLNESILDLYDELLRHEFVPEPFSHFAYSDMQIPLAYGQRML
TPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSEFTANAKRKLEE
HNCNNVELITGDACRGWLESAPYDVMVFTGAMEKLTDTHKLQILPGGKLFAILGKSPVMK
AYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacagtgcacgcataaatatgatcaaacaacagttacgaactggtgatgtatta
aacgaatccatccttgacttatacgatgagctcttaagacatgagtttgttcctgaacct
ttttctcattttgcttattcagacatgcaaattcctttggcatacggtcaaagaatgtta
actccattggaagaaggtacaattttacaatcccttgatcttaaaggtcatgaaactgtg
ttggaagtgggaacaggaaccggttttatgactgcattactcagtaagttatgtaaaaaa
gttatcagtattgactattattctgaatttactgccaatgcaaaacgcaaactcgaagag
cataattgtaataatgttgaattaattaccggagatgcttgtcgtggatggttggaaagt
gcaccatacgatgttatggtattcactggtgccatggaaaaactgacagatacccataaa
ctacaaattttacctggtggcaagttgttcgcaatccttggtaaatcccctgtaatgaaa
gcttatctttttcagttggatcataatgcaatctggacagaatccatgctttttgaaacg
gatatacctcctctggtagatcaattgaaaccgaaagaatttgttttctag

DBGET integrated database retrieval system