KEGG   Legionella pneumophila Paris (serogroup 1): lpp0948Help
Entry
lpp0948           CDS       T00209                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00300  Lysine biosynthesis
lpp01100  Metabolic pathways
lpp01120  Microbial metabolism in diverse environments
lpp01230  Biosynthesis of amino acids
Module
lpp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    lpp0948 (dapE)
Enzymes [BR:lpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     lpp0948 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAH12099
Pasteur: lpp0948
UniProt: Q5X6L7
Position
complement(1052594..1053727)
Genome map
AA seq 377 aa AA seqDB search
MTDIKQILTDLIGFPSITPEDAGCQKYMIQFLEQLGFTCQQLNNGPVSNFFACYGKIGPL
LVFAGHTDVVPVGEVSKWDTDPFSLEEKSGVLYGRGVADMKGSLACMLHMARRFIKTYPS
FPGRLGFLITSGEEGDEFNLGTPYVMQKLEQQGIVIDYCIVGEPSSSLKAGDVIKIGRRG
SLSAKIHLSGKQGHVAYPHLADNPIHRISPVLAELTSMQWDNGNAFFPPTSMQITYIHCG
GHAGNIIPGELNLHLNFRYSTEQTDESLKTRVINAFTHHNLNPAIEWRLNGEPFLTNKGI
LLESCKQTVLEHIGTLPELSTSGGTSDGRFIAPYGVEVIELGLVNATIHQVNECTSLQDL
NTLETMYFSICEKLLID
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattaagcaaattctgactgacctcattggttttccttctattacaccagaa
gatgctggctgccaaaaatacatgattcaatttctggagcaattgggatttacttgtcaa
caactgaataatgggcccgtatccaatttttttgcctgctatggcaaaattgggccttta
ttggtgttcgcaggccataccgatgtagttcctgttggtgaagtatcaaaatgggataca
gaccctttctctctcgaagaaaaaagtggcgtgctctatggtcgtggggttgctgatatg
aaaggcagcctggcctgtatgttgcatatggccagaagatttattaaaacttatccttcc
tttccaggcagactaggatttctgatcaccagtggcgaagaaggcgatgaatttaatttg
ggcaccccttatgtgatgcaaaaactggagcagcaagggattgttattgattattgcata
gtaggtgaaccttcaagcagcttgaaagctggtgatgtcatcaaaattggaaggcgtgga
tcattaagtgccaaaatacatctgagcggaaagcaaggccatgttgcctatccgcatttg
gctgacaatccaattcatagaattagcccagtattagccgaactcacttcaatgcaatgg
gataatggcaatgctttttttccccctacctccatgcaaataacttatattcattgtgga
gggcatgcgggtaatattatcccaggcgaattaaatctgcatttgaactttagatattcg
acagagcaaacagacgagtcgttaaaaacgagagtaattaatgcctttacacaccataat
cttaaccccgctatagaatggcgattaaatggcgaaccattcttaacgaataaaggcata
ttgctagaaagctgcaaacaaacagtgcttgaacatattgggactctccccgaactttca
acaagtggtggaacttcagatgggcgttttatagcaccttatggggttgaggtcatagag
ctgggactggtaaatgcaaccattcatcaggttaatgaatgcacttctctacaggatttg
aatacacttgaaaccatgtatttttcaatctgtgagaaattgttaattgactaa

DBGET integrated database retrieval system