KEGG   Legionella pneumophila Paris (serogroup 1): lpp1065
Entry
lpp1065           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB
Motif
Pfam: DUF3487 PrgI DUF4752 DUF3040
Other DBs
NCBI-ProteinID: CAH12216
Pasteur: lpp1065
Position
complement(1189593..1189955)
AA seq 120 aa
MSQPSSRHLSHDFPAWKGLSLRELFWIVITTTPVTTLLFILLGTMAGYPLAAGCIGFVIG
FIFSITVWPKGVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
NT seq 363 nt   +upstreamnt  +downstreamnt
atgagtcagccttcttcgcgccatctatcacatgactttccagcctggaaaggcttaagt
ctgcgtgaattgttttggattgtcatcactacaacaccagtaactaccttgctttttatt
cttttaggaacaatggcagggtatccactagccgctggctgcatcggttttgtgattgga
ttcatcttctccattaccgtatggccaaaaggagtcgcccgtatcaaagcaggcaaacct
tatggttatgtgatgaagaaaaccattcaatggatggtgcgattaaggctcaaacactcg
ccctggattcattatcagggacagtggcaaaagaataaatctgttggagagcctcatgtt
tga

DBGET integrated database retrieval system