KEGG   Legionella pneumophila Paris (serogroup 1): lpp1071Help
Entry
lpp1071           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAH12222
Pasteur: lpp1071
Position
complement(1191985..1192806)
Genome map
AA seq 273 aa AA seqDB search
MLKLSTLAMGLVLGQQAIAGLYIPGIATSPMQQADNALAKAGLTEFLDEVIEEKDFQLND
AQKQEAKVWGLNEKEEKRYLQLMQSRSGVYYKNLRMTPIDILGLNARDDVEREHFASLAA
RQEAQKVAQNIAWNNAFYKAYNELFKDVPVVGDFDPSPYSPYAHQPIQLKAGETLYLFIR
PDDAVTTIVLQLIDAINRTPNTKLNLLFLDMDNNTIQLWANRHQIPIQLVTSQQITLTPG
NQQFEGLTLAKKQTPLLLIANGKTSQVVDLGRF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagctatctaccctagccatgggattagttcttggacaacaggccatcgctggt
ttgtatatccctggcattgccacctcacccatgcaacaagccgacaatgccttggcaaaa
gcaggccttactgagtttcttgatgaagtcatcgaagaaaaagatttccaactaaatgac
gcacaaaagcaagaagcgaaagtctggggattaaatgaaaaggaagaaaaacgctatctg
caattaatgcagagcaggagtggcgtgtattataaaaacttgcgcatgacaccaattgat
atccttggacttaacgccagagatgatgtggagcgtgaacattttgccagcctggctgct
cgccaggaagcgcaaaaagtggcgcaaaatatcgcttggaacaatgccttttacaaagcc
tataacgaactgtttaaagatgtacccgttgttggcgattttgatccctccccttactca
ccctatgctcatcaacctattcaactaaaagcaggggaaacactctatttatttataaga
cctgatgatgcagttaccaccattgtactgcaactgattgacgcgattaaccgcactccc
aatacaaaacttaacctgctgtttctggacatggacaataacaccatacaactgtgggcg
aaccgacatcagatccctattcaattagtaaccagtcaacaaatcaccctaactcctggc
aaccaacaatttgaaggtttaacgcttgccaagaaacaaaccccattactgttaatagcc
aacggtaaaacctcgcaagtcgtcgatttagggagattttaa

DBGET integrated database retrieval system