KEGG   Legionella pneumophila Paris (serogroup 1): lpp1517Help
Entry
lpp1517           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00010  Glycolysis / Gluconeogenesis
lpp00020  Citrate cycle (TCA cycle)
lpp00620  Pyruvate metabolism
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
Module
lpp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpp1517
   00020 Citrate cycle (TCA cycle)
    lpp1517
   00620 Pyruvate metabolism
    lpp1517
Enzymes [BR:lpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lpp1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Bac_DNA_binding Bclx_interact
Motif
Other DBs
NCBI-ProteinID: CAH12668
Pasteur: lpp1517
Position
1689522..1690634
Genome map
AA seq 370 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVKADQPLVSMETAKAVVDVPCPQSGTIAKLYG
KPGDVIKTGEPLVAFVSTTEKPADKGTVVGNLEESTDVSEDNFIIGSQRSSHRVKTTPAV
RMLAKKLGVDLSSLKGSGDNGVITREDVQNQANINSQPPAGFEPLRGVRRAMLNSMVQSH
AEIVPVSIFDEADIHIWKPNTDITVRLIRAIIHASKKEPALNAWFDTKHAARRCFKEVHL
GIAMDNEEGLFVPVIHDAEKYSDSELRKIIDEFKESVRNRAVSADKLKGATITLSNFGKF
SGRFASPIIVPPMVAILAVGRLYKAPVINDEDKIEAHKMLPLSLSFDHRAITGGEATRFL
GAVIESLQQA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttttaatctacccgatttaggtgaaggtttacctgacgctgaaattcatgaa
tggtttgttaaggaaggcgacacagttaaagcagatcaacctttagtttctatggaaacg
gcaaaagcagttgttgacgtaccctgccctcaatcaggcactatcgcaaaactttatggc
aaaccaggtgacgttatcaaaactggagagcctcttgtagcgtttgtttcaactaccgaa
aaacctgcagataaaggcacagttgttggtaatctggaggaaagtactgatgtgtcagaa
gataattttattattggaagtcagcgttcttctcaccgcgttaagacaacacctgctgta
agaatgttagcaaaaaaattaggagttgatttaagctctttaaaaggtagtggtgacaat
ggtgttattactcgagaagatgttcaaaatcaggccaatatcaattcacaaccacctgcc
gggtttgagcccttgcgaggtgttaggcgagccatgcttaatagcatggtacaatctcat
gcagaaatagttccagtcagtatttttgatgaagcagatatccatatttggaaacccaac
acagacattactgttcgtttaatccgggccattatccatgcgtcaaaaaaggaaccggct
cttaatgcctggtttgataccaaacatgccgcacgtagatgttttaaagaagtgcatctt
ggtattgccatggacaatgaggaaggtttatttgttcctgttatccatgatgcagaaaaa
tactccgacagtgaattaagaaaaataattgatgaattcaaagagtcagttcgtaatcgg
gcggttagtgcagataagctaaaaggggcgacaattacgttgtctaattttggaaaattt
tcaggacgttttgccagtccaataattgttcctccaatggtggcgattttagcggttgga
agactttataaagccccagtaattaatgatgaggataaaattgaagcccacaaaatgctt
cctttatccttgagctttgatcatagagctattaccggaggagaagccactcgattttta
ggtgctgttattgaatctttgcaacaagcatga

DBGET integrated database retrieval system