KEGG   Legionella pneumophila Paris (serogroup 1): lpp1568
Entry
lpp1568           CDS       T00209                                 

Gene name
plaB
Definition
(GenBank) phospholipase
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB
Motif
Pfam: Palm_thioest Hydrolase_4
Other DBs
NCBI-ProteinID: CAH12719
Pasteur: lpp1568
Position
1747969..1749393
AA seq 474 aa
MIVIFVHGWSVTHTNTYGELPQWLENQSKQGKLDIQVGNIYLGRYISFDDTVTVDDIARA
FDQAVRDEIADKLRDGQRFACITHSTGGPIVRKWMDLYFKNNLAKCPLSHLIMLAPANHG
SALAQLGKSRLGRIKSFFEGIEPGKCVLDWLELGSDKSWQLNESWLDYDCTANGVYSFVL
TGQKIDRQFYDAVNSYTGESGSDGVVRVAATNMNYSLLKLHQEGDNGESLVVAKMTRTQP
MAFGVLPGLSHSGKNIGIIRSITMANAANHPTAIWILRCLQVKSRDSYNKLVKELDNITK
ETQKNEHKEFVKTLVFTREYITNRYSMIIFRLIDDRGNHLIDYDLYLTAGPQYSEQALPA
GFFVDRQRNLNNRGKLTYFLDYDIMEGGINTPKMQGNLGFRVKAYPESSDQALAYYRLLD
FHSSLADIHKILHPNETVMVEIMLQRRVDRTVFRISNNLTPAKISGKPTGKKID
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgattgttatcttcgtccatggctggagtgtcacgcataccaatacttatggggaactt
cctcaatggcttgaaaatcagagcaaacagggaaagctggatattcaagtcggcaatatt
tatcttgggcgctacatcagttttgatgatacggtgacggttgacgatatagcacgcgca
tttgatcaagcggtacgtgatgaaattgctgataagctacgagatgggcagcgttttgct
tgtatcactcactctaccggtgggcccattgtccgcaaatggatggatttatactttaag
aataatcttgcaaaatgtccgttaagtcaccttatcatgctggctcctgccaaccacggt
tctgctcttgctcagcttggcaaatcccgcctaggccgcataaagagtttttttgaaggc
attgaaccgggaaagtgtgtacttgattggcttgagctcggaagcgataagagctggcaa
cttaatgaaagctggcttgattatgattgcactgccaatggtgtctattcctttgtactt
actggccagaaaattgatcgccaattttatgatgcagtaaactcctacacaggagaatct
ggatccgatggggtggtacgcgttgctgcaacaaatatgaattatagcttattgaaatta
catcaggagggggataacggtgaaagtcttgttgtcgccaaaatgacacgaacacagcca
atggcatttggagttctacctggactttcacattccggtaaaaatatcggtatcatccgt
agtattactatggccaatgcagccaatcaccccacggcgatatggatcctgcgatgcctg
caagtaaaaagtcgtgactcctataataaattagtaaaagagttagacaatattactaaa
gagactcagaaaaatgagcataaggaatttgtgaaaacacttgtctttacgcgcgagtat
ataaccaatcgttactctatgattattttccggcttattgatgaccgcggcaatcacctt
atcgattatgatctttacctaactgccggacctcaatatagcgagcaggcgcttcctgca
ggtttttttgtagatcgtcagcgaaatctcaataatcgaggtaaactgacttattttctt
gactacgatattatggaaggtggaattaataccccaaaaatgcagggtaatcttgggttt
cgtgttaaagcatatcctgaatcaagtgaccaagcccttgcctattacaggttacttgat
tttcattcatcgcttgctgacattcacaaaatacttcatccgaatgaaaccgtaatggtt
gaaatcatgcttcaaagacgagtagataggacagttttccgtatcagcaacaaccttact
ccggcaaaaatcagtggaaagccaactggcaaaaagatagattga

DBGET integrated database retrieval system