KEGG   Legionella pneumophila Paris (serogroup 1): lpp1788Help
Entry
lpp1788           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00071  Fatty acid degradation
lpp00072  Synthesis and degradation of ketone bodies
lpp00280  Valine, leucine and isoleucine degradation
lpp00310  Lysine degradation
lpp00362  Benzoate degradation
lpp00380  Tryptophan metabolism
lpp00620  Pyruvate metabolism
lpp00630  Glyoxylate and dicarboxylate metabolism
lpp00640  Propanoate metabolism
lpp00650  Butanoate metabolism
lpp00900  Terpenoid backbone biosynthesis
lpp01100  Metabolic pathways
lpp01110  Biosynthesis of secondary metabolites
lpp01120  Microbial metabolism in diverse environments
lpp01130  Biosynthesis of antibiotics
lpp01200  Carbon metabolism
lpp01212  Fatty acid metabolism
lpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    lpp1788
   00630 Glyoxylate and dicarboxylate metabolism
    lpp1788
   00640 Propanoate metabolism
    lpp1788
   00650 Butanoate metabolism
    lpp1788
  09103 Lipid metabolism
   00071 Fatty acid degradation
    lpp1788
   00072 Synthesis and degradation of ketone bodies
    lpp1788
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lpp1788
   00310 Lysine degradation
    lpp1788
   00380 Tryptophan metabolism
    lpp1788
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lpp1788
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lpp1788
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    lpp1788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpp04147]
    lpp1788
Enzymes [BR:lpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lpp1788
Exosome [BR:lpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpp1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAH12940
Pasteur: lpp1788
Position
2019435..2020619
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgcgcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacat
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaacccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcgggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system