KEGG   Legionella pneumophila Paris (serogroup 1): lpp1980Help
Entry
lpp1980           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00790  Folate biosynthesis
lpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpp1980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpp04147]
    lpp1980
Enzymes [BR:lpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     lpp1980
Exosome [BR:lpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpp1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: CAH13132
Pasteur: lpp1980
UniProt: Q5X3Q4
Position
2242697..2243038
Genome map
AA seq 113 aa AA seqDB search
MTSDLSSKHCESCEGIGAALNSEQIKNLLPQLNTKWEVTEDNRIIKRAFSFKNFYETMAF
VNAIAWIANIENHHPDLEVGYNYCRVHFMTHALNGLTHNDFICAAKIDKLLVD
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgactagtgatttaagtagtaagcattgtgaatcttgcgagggaattggcgctgcgctc
aactccgagcaaatcaaaaatttactacctcaattaaacacaaaatgggaagtaacagag
gacaaccgaattatcaagcgtgctttttcatttaaaaatttttatgaaacgatggctttt
gtcaatgcgattgcctggatagcaaatattgaaaatcaccaccctgatttagaagtcggc
tacaattattgccgtgttcactttatgacgcatgcacttaatggtttaactcataatgat
tttatttgcgcagcaaaaatagataagttactggttgattaa

DBGET integrated database retrieval system