KEGG   Legionella pneumophila Paris (serogroup 1): lpp1992Help
Entry
lpp1992           CDS       T00209                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00230  Purine metabolism
lpp01100  Metabolic pathways
Module
lpp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lpp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lpp1992 (gmk)
Enzymes [BR:lpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lpp1992 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MobB NTPase_1 Glyco_transf_5 AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: CAH13144
Pasteur: lpp1992
UniProt: Q5X3P2
Position
complement(2254347..2254976)
Genome map
AA seq 209 aa AA seqDB search
MVSDNSGNLYIVAAPSGGGKTSLVKKLIEMVGEIEVSVSHTTRPMRPGEKEGVDYFFIDE
EQFISMVNEGAFIEHAKVFNHWYGTSVAQINKRLQFGIDVVLDIDWQGAEQIRHSYPDAV
SVFIIPPSLDTLKERLMNRRQDKDNVISERMTKAQDELGHYPEFDYLIVNDDFEKAAMEL
QSIVIANRLRIEKQVNKQAKLLSFLLSSQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggttagtgataattcaggaaatttatatattgttgcagcaccctccggaggaggaaaa
acaagtttggtgaaaaaacttattgaaatggtgggtgagattgaagtatcggtttctcat
acgacaagacctatgaggcctggagaaaaagaaggagtggattattttttcattgatgag
gaacaatttatttctatggtgaatgagggggcgtttattgagcatgccaaagtatttaac
cattggtatggtacctcagttgctcaaattaacaaacggttacaatttggaattgacgtc
gttcttgatattgattggcaaggagcggagcaaattagacactcctatccggatgcagtg
agtgtatttatcattcccccttctttagacacattaaaagaacgcttgatgaacaggcga
caagataaagataatgtgattagtgagagaatgaccaaagcacaggatgaacttggccat
tatcctgaatttgattatctgattgttaatgatgattttgaaaaggcagcaatggaatta
cagtcgatagtaattgccaataggcttcgaattgaaaaacaggtaaataaacaagccaaa
ttgctttctttcctcttgtcatcgcagtaa

DBGET integrated database retrieval system