KEGG   Legionella pneumophila Paris (serogroup 1): lpp2035Help
Entry
lpp2035           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00900  Terpenoid backbone biosynthesis
lpp01110  Biosynthesis of secondary metabolites
lpp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lpp2035
Enzymes [BR:lpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     lpp2035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CAH13187
Pasteur: lpp2035
Position
2299812..2301110
Genome map
AA seq 432 aa AA seqDB search
MSIAANAGELFRGFSKLSREERFQRLCALGALTHEDITFLKQGGIKDLNLADKLIENVVG
YFQLPLGVATNFNIDGRDYVIPLAVEETSIIAALSKSAKWIRQHGEINTWVHGECILGQI
QLAKVKDFHRFSDLFNKNRQYFIEIANKDVAANMVKRGGGVTDLQVRHLKREDGQDMAVI
HLTMNSCDAMGANIINQVLEYLKQPIEQITGEEVTMCILSNLNDQKLTTAQVIIRNIDPI
LGQKLQEASLFAEIDPYRAATHNKGVMNGIDPVLIATGNDWRAVEAGIHAYAARSGQYKA
ITRWRYQNEILTGELTAPIIVGTVGGVTSLHPTAKMCLRMMDITSANQLSQVIAAVGLVQ
NLGALKALCTDGIIQGHMKLHIDNLLLVAGANENEMPVLKEKLQEWLNLNKRVSLNNAYD
LLAEIRQAPVAV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagctgctaatgccggtgaattatttcgcggattctcaaagttatcacgtgaa
gagcgctttcaaaggttatgcgctttaggtgccttgactcatgaagacataacatttctt
aaacaaggcggtattaaagatttaaatctggccgacaaattgattgaaaatgtggttgga
tattttcagcttccattgggtgtggctactaattttaatattgatggacgtgattatgta
atacctttggcagtggaagaaacctctattattgctgctctatccaaatcagcgaaatgg
attaggcagcatggtgaaatcaatacctgggttcacggagaatgtattcttgggcaaatt
caactggcaaaagtaaaggactttcacagattctctgatctctttaataaaaatcgtcaa
tattttatagaaatagcgaataaagacgttgccgccaatatggtcaaacgaggcggcggt
gttaccgatttgcaagtacgtcatttaaagagagaagatgggcaagatatggcagtaatt
catttgacgatgaacagctgcgatgctatgggtgccaatatcatcaatcaagtacttgaa
tatttaaaacaacccatagaacaaataactggtgaagaagtcaccatgtgtattttatcc
aatttaaacgatcaaaaattaacaaccgctcaagtcattattcgtaatattgaccccatc
ctcggtcaaaaattgcaagaggcctcactctttgcagaaatagatccctatcgcgctgcc
acccataataaaggggttatgaatggaattgatccggttttaattgctacagggaatgat
tggcgagctgtggaagctggaatacacgcctatgcggcacgttcgggacaatacaaagcg
attactcgctggcggtatcaaaatgaaatactcacaggagagttaactgctcctatcata
gtaggtactgttggaggcgtaacatctttacaccccacggctaaaatgtgtttacgaatg
atggatatcacttctgccaatcaactctcccaggtgatcgcagcagttggactagtacaa
aatcttggcgcactcaaagctttatgcactgacgggatcattcaaggccatatgaaattg
catattgataatttgctattagttgcaggggctaatgaaaatgaaatgcccgtgctcaaa
gaaaaattgcaagaatggcttaacctgaacaaacgagtcagcttgaataacgcttatgac
ctattagctgaaatccgacaagctcctgttgcagtatga

DBGET integrated database retrieval system