KEGG   Legionella pneumophila Paris (serogroup 1): lpp2356
Entry
lpp2356           CDS       T00209                                 

Gene name
copA1
Definition
(GenBank) hypothetical protein
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Brite
Enzymes [BR:lpp01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     lpp2356 (copA1)
Motif
Pfam: E1-E2_ATPase Hydrolase HMBD Hydrolase_3 DUF2116 MASE3 HAD
Other DBs
NCBI-ProteinID: CAH13509
Pasteur: lpp2356
Structure
PDB: 
4BBJ 4BYG 3RFU 4BEV

Position
complement(2698228..2700438)
AA seq 736 aa
MKHDHHQGHTHSGKGHACPHEHNSPKTQQASSKMEGPIVYTCPMHPEIRQSAPGHCPLCG
MALEPETVTVSEVVSPEYLDMRRRFWIALMLTIPVVILEMGGHGLKHFISGNGSSWIQLL
LATPVVLWGGWPFFKRGWQSLKTGQLNMFTLIAMGIGVAWIYSMVAVLWPGVFPHAFRSQ
EGVVAVYFEAAAVITTLVLLGQVLELKAREQTGSAIRALLKLVPESAHRIKEDGSEEEVS
LDNVAVGDLLRVRPGEKIPVDGEVQEGRSFVDESMVTGEPIPVAKEASAKVIGATINQTG
SFVMKALHVGSDTMLARIVQMVSDAQRSRAPIQRLADTVSGWFVPAVILVAVLSFIVWAL
LGPQPALSYGLIAAVSVLIIACPCALGLATPMSIMVGVGKGAQSGVLIKNAEALERMEKV
NTLVVDKTGTLTEGHPKLTRIVTDDFVEDNALALAAALEHQSEHPLANAIVHAAKEKGLS
LGTVEAFEAPTGKGVVGQVDGHHVAIGNARLMQEHGSDNAPLFEKADELRGKGASVMFMA
VDGKTVALLVVEDPIKSSTPETILELQQSGIEIVMLTGDSKKTAEAVAGTLGIKKVVAEI
MPEDKSRIVSELKDKGLIVAMAGDGVNDAPALAKADIGIAMGTGTDVAIESAGVTLLHGD
LRGIAKARRLSENTMSNIRQNLFFAFIYNVLGVPLAAGVLYPLTGLLLSPMIAAAAMALS
SVSVIINALRLKRVTL
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgaaacacgaccaccatcaaggacatacccattctggtaaaggacatgcttgtcctcac
gaacataattctcccaagactcagcaagcctcttccaaaatggaggggcctattgtttat
acgtgtcccatgcacccagaaattcgccaatctgcccctggtcattgtcctctttgtggt
atggctttagaaccggaaacggtgacggtttcggaggttgtgagccctgaatatcttgat
atgagacgtcgattttggattgcattgatgttaactatacctgttgtgatattggagatg
ggtggacatggtttgaagcattttatttctggtaatggttccagttggatccaattgctt
cttgccacgccagtggtgttatggggaggttggccttttttcaagcgcggttggcagtct
ctaaaaacaggccaactcaatatgtttaccttgattgccatgggtattggtgtggcgtgg
atttacagtatggtggctgtcctttggccaggtgtatttccccatgcgtttcgaagtcaa
gaaggagtagttgctgtttattttgaagcggcagcagtgattactacgcttgtcttgttg
gggcaagtgctggaactaaaagctcgagaacaaacgggtagtgccatccgtgccttgtta
aaattggtccctgaaagtgcacaccgaattaaggaagatggcagtgaagaggaagtgtcc
ctggataacgttgccgttggtgatttgttgcgtgttcggcctggtgaaaaaataccagtg
gatggtgaagtgcaagaaggccgaagctttgtcgatgaatccatggtgacgggtgagccc
attccagttgctaaagaggccagcgctaaagttattggtgctacgattaatcagacgggt
agctttgtcatgaaagcgctgcatgtgggcagtgataccatgcttgcacgcattgtgcag
atggtgagtgatgcccaacgaagccgtgcgccgattcagcgactagccgataccgtctca
ggatggtttgtgcccgctgtgattttggttgcggtgctgtcttttattgtgtgggcactg
ttgggtccgcaaccagcgcttagctatggtttaatcgctgctgtgtcagtactcatcatc
gcttgcccttgtgcgttaggtttagcaacgcccatgtccattatggtcggtgttggaaaa
ggagcacaaagcggggtattgattaaaaatgccgaagcgttggaacgaatggagaaggtc
aataccctggtggtcgataaaacgggcacgcttactgaaggtcaccctaaattgacacgc
attgtgaccgatgatttcgtggaggataatgctttagcattagctgcggcacttgagcat
caaagtgaacatccgctggccaatgctattgtgcatgctgcaaaagaaaaaggattgtcc
cttggaacagtcgaagcgtttgaagcgcccactggaaaaggggttgtaggtcaggtagac
ggccatcatgttgctattggtaacgccagattaatgcaagagcatggaagcgataatgcc
cctctttttgaaaaggctgatgaacttcgtggtaaaggcgcctcagtcatgtttatggcg
gttgatggtaaaacagtagctctcttggtggttgaagaccctattaaatcgagtactcca
gagaccatcctcgaacttcagcaaagtggcattgaaattgtcatgctcaccggagatagc
aaaaaaacagcagaagcggtggcagggaccctcggcattaaaaaggtggtagctgaaatc
atgcctgaagacaagagtcgcatcgtgagtgaattaaaagacaaaggtcttattgttgcc
atggcaggagatggggtgaatgatgccccagcgcttgccaaagctgatattggtattgcc
atgggaacaggcactgatgtggccatcgaaagtgctggggtcaccttgttgcatggagat
ttgcgtggtatcgccaaagcgcgacgtttgtcagaaaataccatgagcaacattcgccaa
aatcttttcttcgcctttatttataatgtactgggtgtgcctttggctgctggggttttg
taccccctaaccggcttgctcttaagtcctatgattgcagcagcggcgatggcgctttct
tcagtgtcagtgattatcaatgcgctgagactaaagagagtgacactatga

DBGET integrated database retrieval system