KEGG   Legionella pneumophila Paris (serogroup 1): lpp2388
Entry
lpp2388           CDS       T00209                                 
Name
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB
Motif
Pfam: DUF2895 HAD_SAK_2 TraE
Other DBs
NCBI-ProteinID: CAH13541
Pasteur: lpp2388
Position
2731977..2732639
AA seq 220 aa
MFHYWKKVDSLNHINRLLLAFVSVLILIVFGLIITLAKIPNRFEFWLTPSMSSNGGLVKE
NAIPKEYVQGFVATLLPTLNTWSQGGKKEFATNLSGFHYYFTPRHQALMDKTLIAYKDAQ
LFNRIQVASLYRFMENEDVKVIAHNTWEVHLVLRITQRLKDDSPMVIADKIVDYHVRVVK
VNLSRLQNPFQLALDGYTQPETLITDLLATNTRGTQHDNN
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtttcattactggaaaaaagtggacagtttaaatcatatcaatcggttgttattagcc
tttgtatccgtactcattttgattgtatttggactgatcattacgctggctaaaataccc
aatcgttttgaattttggctaacaccttctatgagtagtaatggtggattagtcaaggaa
aacgccatacccaaagaatacgttcagggttttgttgccacactgctacccaccttaaac
acctggtcacaaggtggtaaaaaagaatttgctactaatctttcaggctttcattactac
ttcactccacgacatcaggcattaatggataaaaccttgatagcttataaagatgctcaa
ctttttaatcgcatacaagtagcaagtctttatcggtttatggaaaacgaagatgtcaaa
gtaatcgctcataacacatgggaagttcatctggttttacgcattacccaacgcttaaaa
gacgatagccccatggtcattgcagacaagattgtggactaccatgtgcgtgtggtcaag
gtcaatctctctcgcttacaaaatccttttcaactggcattggatggttatacccaacca
gaaacactaatcaccgatttattggcaaccaatacaagaggtacacaacatgacaacaac
taa

DBGET integrated database retrieval system