KEGG   Legionella pneumophila Paris (serogroup 1): lpp2389
Entry
lpp2389           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB
Motif
Pfam: DUF3438 TraK
Other DBs
NCBI-ProteinID: CAH13542
Pasteur: lpp2389
Position
2732626..2733408
AA seq 260 aa
MTTTKWLLTIIALISSQYALALDAEHVLWDKTPIPVELSLNEERLIHFPQAISIVDNEAA
SQTALLKIQDALYLKGKDVFKNKRLLVQLMPQGEVIILNLSVNDKTHDVKPIEVLLESKE
NTNSPQEVVNPLDLNAVTLTRFAIQSLYAPQRLLVIPDGVGRVPMQTRKQVSLFYGASIE
ARPLISWHGGAFYVTAVELKNLLNKEVIVDPRQMMGNWQTATFYPTNTLSPRSNKESTTV
FLVSDRPFGTALSASREYVR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgacaacaactaaatggttactcaccataattgccttaattagcagccaatacgcgcta
gctctggatgcagaacatgtcttgtgggataaaacacccatccctgtcgaactatccttg
aatgaggaaaggctcatccattttcctcaagccattagtattgtagataatgaagcagcc
tctcaaaccgcgcttttgaaaattcaggatgctttgtatctgaaaggcaaggacgttttt
aaaaacaaaaggctcttggtgcagctcatgcctcaaggtgaggtcattatcttaaactta
agcgttaatgataaaactcatgatgtaaaaccaatagaagtacttttggaatccaaagaa
aataccaactcccctcaagaagtggttaacccgctggatttaaatgcagtaacactgacg
cgctttgccatccaatctttgtatgccccacaaagactgttggttattcctgatggtgtg
gggcgtgttcctatgcaaacccgaaaacaagtaagccttttttatggtgccagcatcgaa
gcaagaccattgatttcatggcatggtggtgcattttatgtaactgcggtggaattgaaa
aacctgctgaacaaggaagtaattgttgatcctcgccaaatgatgggtaactggcaaacc
gctaccttttaccccaccaacactttatcacctcgtagtaataaagagtccactacggta
tttctggtatcagacaggccctttggcacagcgctttccgcaagtcgggagtacgtacga
tga

DBGET integrated database retrieval system