KEGG   Legionella pneumophila Paris (serogroup 1): lpp2391
Entry
lpp2391           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: CAH13544
Pasteur: lpp2391
Position
2734675..2735064
AA seq 129 aa
MAIYNKLHTILALGSVLVLSACASKTVGSTAIPEGGLTVSQLYQQSLGDAMPGWSVPKRQ
AKIVNYSGYTRDASNEIQHLFKPLDNPQVPIYVFPHVAVIGDEQLLKPGYTTAFFLYKQN
QFALASEHY
NT seq 390 nt   +upstreamnt  +downstreamnt
atggccatttacaacaaactgcacacgattttagccttaggtagcgtcttggtgcttagt
gcttgcgcctcaaagacagttggctccacagctattcccgaaggaggattgactgttagc
caactttatcagcaaagcttaggtgatgccatgcctggctggtctgtacctaaaagacag
gcgaagatcgtgaattattcagggtatacacgagatgcttccaacgagatccaacatttg
ttcaagcctttggataacccacaagttccgatttatgtgtttcctcatgttgctgtcatt
ggtgatgagcaattgttaaaaccaggctataccacagccttttttctctacaaacaaaat
caatttgcactagcttccgaacactattaa

DBGET integrated database retrieval system