KEGG   Legionella pneumophila Paris (serogroup 1): lpp2395Help
Entry
lpp2395           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-ProteinID: CAH13548
Pasteur: lpp2395
Position
2740213..2741781
Genome map
AA seq 522 aa AA seqDB search
MVVFSPLSLYTTYLGWQQYEVIFNALWQTGLLYLGFLMVGYRFLKNVLAPSGATHHAAEY
ALNHFLYELAITFLICGIFIYPCVPLEEKAMSFKPMCGIKKGTDAKTSTLKDTGTTYDEA
FADVLTPNVKMPIGFALLQNYMSGITYGLMKVTGCTDSLQAIEGDLISTYLPADVREQAL
NFHRQCFLEARSQYHNEPHDKTKVNDILKKYGGEEDLKWVGSKVYQTLYYDKIYARQPVA
GFTFNEAPNKNLEKAAERGDIDAKHLPEQGYPTCNQWWKKLKTDLVQVANNASVFDRHLN
YYAVLDRVRTFKNNHPKAWGSQLGSEDYIAKMLLNDSRDMQANSMKNLMGNTNGAFGGAI
SHGLVNIGQLTKSWTSTPLKREAIMQTLPVMQAFLYFFLIILTPVILALSGYNPKTLGSI
CGLFIMAIFLQYLWHLVGFVERSVLDPLGQNDAIAAMRNMAVLFYFIAPMLLLKLSSHFG
GEAGAALGALVNDAAQHSNKVANSGVDTIKQGAKIASMGKVK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggttgtatttagccctttatccttgtacaccacctatttaggctggcagcaatatgag
gttatttttaatgccctgtggcaaaccggtttgttataccttggttttcttatggtaggg
tatcgattcttaaaaaatgtgctggcaccttctggtgctacacatcacgcggcagaatat
gccttgaatcattttctttatgaattggcaattacttttttgatttgcggcatctttatc
tacccctgtgtgccattggaagaaaaagccatgagttttaagcctatgtgcggtataaaa
aaaggaacagatgcaaaaacctctacgttaaaagatacaggtactacttatgatgaagca
tttgcagacgtactaacccccaatgtcaaaatgcctattggttttgcacttttgcaaaat
tacatgtcaggaattacctacggcttaatgaaagtgaccggttgcaccgacagcttacag
gcgattgaaggcgatttaatttccacctatttacctgctgatgtacgtgaacaagcattg
aattttcacagacaatgcttccttgaggccagaagccaatatcacaatgaaccgcacgat
aaaactaaggtcaatgacattttaaaaaaatacggtggtgaggaagatttgaaatgggtg
ggttccaaagtctatcaaacactatactatgataaaatttacgcaagacaacccgtagct
ggctttacctttaacgaagcccccaacaaaaatctcgaaaaagcagcagaacgtggtgat
attgatgccaaacatctgccagagcaaggctatcccacctgcaatcaatggtggaaaaag
ctcaaaacagatttggtgcaagtagccaataacgccagtgtctttgacagacacctgaat
tactacgcggttttagacagggtccgcacattcaaaaataaccatcccaaagcctggggt
tcgcagttaggctcagaagactacattgccaagatgttgcttaatgacagtcgcgacatg
caggctaacagtatgaaaaacctaatgggaaacaccaatggggcttttggtggtgccatt
tctcatgggttagtaaatattgggcaattaacaaaatcatggacatcaacgccattaaag
cgtgaagccattatgcaaacgctacctgtcatgcaggcctttttgtatttcttcctgatt
atcttgactcctgtgattttggctctaagtggttataaccctaagacgttaggcagtatt
tgcggtctgtttataatggcgatattcctgcaatacctatggcatctggtgggctttgtc
gaacgcagtgtgcttgatcctttaggacaaaacgatgccattgcagccatgcgcaatatg
gcggttttattctactttattgcacccatgttgctattaaaactgtccagtcattttggt
ggggaagcaggagcagcccttggtgcattggttaatgacgcagcacaacacagtaacaaa
gttgctaactcaggtgtggataccatcaagcaaggggcaaaaatagccagcatggggaaa
gtaaaatga

DBGET integrated database retrieval system