KEGG   Legionella pneumophila Paris (serogroup 1): lpp2711
Entry
lpp2711           CDS       T00209                                 

Gene name
feoB
Definition
(GenBank) ferrous iron transporter B
  KO
K04759  ferrous iron transport protein B
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpp02000]
    lpp2711 (feoB)
Transporters [BR:lpp02000]
 Other transporters
  Others
   lpp2711 (feoB)
SSDB
Motif
Pfam: FeoB_N Gate FeoB_C MMR_HSR1 PduV-EutP SRPRB AAA
Other DBs
NCBI-ProteinID: CAH13864
Pasteur: lpp2711
UniProt: Q5X1N2
Structure
PDB: 
3IBY

Position
complement(3091262..3093517)
AA seq 751 aa
MTHALLIGNPNCGKTTLFNALTNANQRVGNWPGVTVEKKTGEFLLGEHLIEITDLPGVYS
LVANAEGISQDEQIAAQSVIDLEYDCIINVIDACHLERHLYLTSQLFELGKPVVVALNMM
DIAEHRGISIDTEKLESLLGCSVIPIQAHKNIGIPALQQSLLHCSQKIKPLKLSLSVAAQ
QILNDLENQLISKGYKNSFAYYFSRRLAEGDTLIGEKAFTESLLIKLQETEQNLDVLLAD
ARYQKIHEIVTLVQKKHSDASEHFTAKLDKLVLHRFLALPIFFAMMYLMFLFAINIGGAF
QDFFDISTETIFVQGSGWLLQQLHAPNWVIALVANGVGKGINTTITFIPVIAAMFFFLSL
LETSGYMARAAFVVDKAMRAMGLPGKSFVPMIVGFGCNVPAIMAARTLDSERDRLLTVMM
SPFMSCSARLAIYAVFVAAFFPSGGHNVVFSLYLIGILMAVFTGYILRKTTLKGHASPLI
LELPAYHRPSLRRLLRETSLRLRFFVYRAGKLIIPICVILGGLNAITWGGGISSGEANTD
SLLSIIGQWITPLFAPMGIHQDNWPATVGLLTGMLAKEVVVGTLNSLYAQVGHVGEIAAA
HFDFWGGIKAAFGSIPANLSELGSALWNPVSASAADSELSQSVYGIMSRRFDGAVGAYAY
LLFVLLYIPCVSTMAVIRQEANKRFMWTSIVWSFVVAYTTSVVFYQGAKFLDHPQQSMIW
ILAMSLSLLFVLAVFRYSQYGMGRQNAAANT
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgactcatgccctattaataggaaatcccaattgtggtaagacaaccctattcaatgct
ttgaccaatgcgaatcaacgcgtaggcaactggcccggagtaactgttgagaaaaaaaca
ggtgaatttttgcttggagaacatttaattgaaatcactgatttgccaggtgtctattct
ctggttgcgaatgccgaaggaataagccaggatgagcaaattgctgctcagtcagttatt
gatttggaatacgattgcatcattaatgttatagatgcttgtcaccttgaaagacatttg
tatttaaccagccaactttttgagttaggtaaacctgttgttgtagcacttaacatgatg
gatattgccgagcatcggggtatttctattgatacagagaaactcgagagtttgttaggg
tgttctgttattcccattcaggcccataaaaacattggtattccggcacttcagcaatca
ttacttcattgctcccaaaagataaaacctctaaaactttccttatcggttgcagcgcaa
caaattttgaatgacctggaaaatcagctgatctcaaaagggtataaaaattcctttgcc
tactatttctcccgtaggcttgccgaaggggatactttgataggagagaaagcttttacc
gagagtcttcttataaagcttcaagaaacggaacaaaatcttgatgtgttattggcagac
gctcgctatcaaaaaatccatgaaattgttacgttggttcaaaaaaagcatagtgatgcc
agcgaacacttcactgctaaattggataaacttgttttgcatcgctttttagctttgccc
atattttttgcgatgatgtatttgatgtttttgtttgctataaatattgggggagcattc
caggatttttttgacattagtacagagactatctttgttcagggtagtggttggttgttg
caacagctccatgcaccaaattgggtaatcgcgcttgtagctaatggggtaggcaaagga
attaataccaccattacttttattcctgtgattgccgcgatgtttttctttttgtcctta
ttggaaacttcgggctatatggcaagagctgcttttgtcgtggataaagcgatgcgagcc
atgggattaccaggaaaatcatttgtacccatgattgtgggttttggatgtaatgtccct
gccattatggcagcacgcaccctggattcggagcgcgatcgattattaactgtgatgatg
agtccatttatgtcttgtagtgcccgactggctatttatgcagtatttgtcgcggccttt
tttccctctggcgggcataatgttgttttttcgttgtatttgattggcattttaatggcc
gtatttaccggatatattttacgcaaaactacgttgaagggacatgcttctcctttgatt
ttggagttacccgcttatcatagaccctcactcagaagattgctgagagaaacctccttg
cgattacgattttttgtttatcgtgcgggtaagctgattattcccatttgtgtgattctg
ggaggattaaatgcgattacttggggaggagggattagctccggagaagccaatacggat
tctttattgtcaataataggtcagtggattactccattatttgctccaatgggaattcat
caagacaactggcccgcgactgtcggtttattaactggcatgctggctaaagaggtagtg
gttggcaccttaaactcactttatgcccaagtaggccatgtgggagaaatagctgctgct
cactttgatttttgggggggcatcaaagctgcttttgggtctattcccgccaatttgtct
gaattaggctctgcattgtggaaccctgtttctgccagtgcagctgatagtgagttatct
caatctgtctatggcattatgtcacgacgttttgatggagctgtaggagcctacgcttat
ttgctttttgttttgctttatatcccttgtgtttcgactatggcagtgattcgccaggag
gcaaacaagcgatttatgtggacttccattgtttggtcatttgtcgtggcttacaccact
tccgttgtcttttatcaaggcgctaaatttctggatcatcctcaacaaagtatgatctgg
attttggctatgtcactgagcctgctttttgttttagctgtatttcgttatagccagtat
ggtatggggaggcaaaatgctgctgcaaatacgtga

DBGET integrated database retrieval system