KEGG   Legionella pneumophila Paris (serogroup 1): lpp2718Help
Entry
lpp2718           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Pathway
lpp00020  Citrate cycle (TCA cycle)
lpp00620  Pyruvate metabolism
lpp01100  Metabolic pathways
lpp01120  Microbial metabolism in diverse environments
lpp01200  Carbon metabolism
lpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpp2718
   00620 Pyruvate metabolism
    lpp2718
Enzymes [BR:lpp01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     lpp2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CAH13871
Pasteur: lpp2718
Position
complement(3097910..3099325)
Genome map
AA seq 471 aa AA seqDB search
MFKKILVANRGEIALRIVRACKEMGIAAVTIHSEVDRFALHVKRASHSHCLSKKPLDAYL
NGRRIIECAKVAGCEAIHPGYGFLSENAEFAEDCNKAGIVFIGPSAPVIATMGSKIAARE
AMIKAGVPTIPGSKGNLETIDDALHCAETLGYPVMLKATFGGGGRGIRLCHDASQIKQQF
ARVQSEAEKSFGDSHIYMEKYIANPRHIEVQILADHHGTVLHLFERDCSIQRRHQKLVEI
APSPQLDEATRQVLLGYAVKAAKEVGYTNAGTVEFILDKNNQPYFMEMNTRLQVEHPITE
QITGIDLVQEQIRIAAGERLTISQEQVKYNGFAIEFRINAEDPQNDFLPSFGRITRYYAP
GGPGVRTDSAIYTGYQIPPDYDSLCAKLTVWAFDWPSVLRRARRALEEMRMFGVKTTIPY
YLEMIKSEEFQKGVFNTGLVEAHPEWLKYSNKSLPQHKAAVIAAAIALNKT
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattctggtggctaatcgcggtgagatagccctgcgaatagtacgtgct
tgcaaggagatggggatagcagcagttactattcacagtgaagtggacagatttgccctg
catgtcaaaagagcttctcattctcactgtcttagtaaaaaacctctggatgcttatctt
aatggacggcgtattattgagtgcgccaaggtggccggttgtgaagcaattcaccccggg
tatggttttttatctgaaaatgccgagtttgctgaggattgtaataaggcaggtatcgtt
tttataggaccgtctgctccagtgatagccactatgggctccaagattgcagcaagagaa
gcgatgataaaagcgggggttcccaccataccaggaagcaaggggaatttggaaactatc
gatgacgctttacattgcgcagaaactctagggtatcctgtaatgctcaaagcgactttt
ggaggggggggtagaggtatcagattatgtcatgatgccagtcagataaagcaacagttt
gctcgtgtgcaatctgaagcagaaaaatcatttggagactcccatatctacatggaaaaa
tacatagcgaatccacgccatatcgaagtacaaatcctagcagatcatcatggaacagta
cttcatttgtttgaacgagattgttcaatacaaaggcgtcatcagaaactggttgaaata
gccccttctccccaattggatgaggcgacacgtcaagtgcttttgggatacgcagtcaag
gcagccaaggaggtagggtataccaatgcgggtactgttgaatttattttggataaaaat
aatcaaccttacttcatggaaatgaacactcgtttacaggttgaacatccaattacagaa
cagattactggtattgatttagtccaggagcaaattcgaattgcagctggcgagcgtctg
actatctctcaagaacaagttaaatacaatggttttgccatcgaatttcgcattaatgca
gaagaccctcaaaacgattttttacccagttttgggcggattacccgatattacgccccg
ggaggacccggtgtgaggacagatagcgcaatctatactggttaccagattcccccggat
tatgattctttgtgtgccaaattgaccgtatgggcttttgattggccctcggtacttcga
cgagcgcgtcgagctcttgaggaaatgcgcatgtttggagtaaaaactaccattccttat
tatttagaaatgataaaatcagaggagtttcagaaaggggtattcaataccggtttagtg
gaggcacaccccgaatggttaaagtattcaaataaatccttgcctcaacacaaggcagcg
gttattgcagcggcaatcgctttaaataaaacctag

DBGET integrated database retrieval system