KEGG   Legionella pneumophila Paris (serogroup 1): lpp2745Help
Entry
lpp2745           CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K01533  Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Brite
Enzymes [BR:lpp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     lpp2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase E1-E2_ATPase Hydrolase_3 HMA RTP1_C2
Motif
Other DBs
NCBI-ProteinID: CAH13898
Pasteur: lpp2745
Position
3129165..3131708
Genome map
AA seq 847 aa AA seqDB search
MSKPYYFYVSGMNCTSCSNAIESFLRNSNLIKINTFHADMSTPDPKKIVISLSEEKENEH
ESNWKTIKKLIDDTGFTCENYEFPQVRDQKPALPLEKTQTTVQQEASQLSALFSSAKKII
TSHWLLGGLGCITGVSLMILTMALGGLPLAVMIPLASISTLLTIALGAQSYYEAWKKLVQ
SRTLTMDTLFSISTISVLVVSLASFFVPWLPMMFEAGLLIYGFRHIGIAIEDTIKDKISS
AKFQDRAPQKVRLYRHPDFKKTRIDEIQPNDIIQVKPGELIPLDSVCEQDTLIYPTIITG
AVIPKQFRSGEKILAGMRLANDAKPLSLRVLKTAKESYLARLDESIAQSVLEKAPIEVKT
GQLLSYFIPSIIALSILSGIIVGLIATPALAIQCAISVLVSACPCTLGLIIPLAVKTGIH
KGAEHGVQFKNSRVLQLAEQIDVVIFDLNGTLTTGVPVVKEYAVLNDADLSSEQFLSICN
VLEEQSKHPFGKAIQSFTQGINKQKFNIANLDHSNHSGVSAEINGIQYTIGSKTLMQEIG
ISTFSLENQMNLVAGDSLVFLARNKQLLGYLVITDPLRKDAKQTVDALIKMGKEVHLCTG
ADEKTAYRYAQALGIKKVHANCVATTINTEDRSKPVYIKSLQNQGLKVAMIGDAANDANA
LAASDFGIAVLSQDSDEITQQHASAIIQSGTILPIANAFAISKQTVNNINQNLLISLGYN
LTTVLIAGGLLVALGFVLNPAVGVALMVTQACFVLLNVYRFKEQPLQHLQDKVQEKPEPA
PSSYEAMKKHSPNFHTAPEINHSQAIQSGKQPTNKNKSPSFWSDYFPELFEEEKDTSTEH
LMNNKIG
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaccttattatttttatgtcagcggaatgaattgcaccagttgcagtaatgcc
atagagtcctttttaagaaattccaatttaatcaaaatcaatacatttcacgcggacatg
agcaccccggatccaaaaaaaattgtgatatctctttctgaagaaaaggaaaatgaacat
gaaagcaactggaaaaccattaaaaaattaattgatgatacaggttttacttgcgaaaat
tatgaattccctcaggtgagagatcaaaaacctgctcttcctctcgagaaaacgcagaca
accgttcaacaggaagccagccaattatccgcactctttagcagcgcaaaaaaaataatc
acctcccattggttgcttggaggattgggttgtatcactggggttagcttaatgatcctg
actatggctctaggtggtttaccacttgcggtaatgatccctttagcaagcatcagcact
ttattaactattgcgcttggtgcccaatcttattacgaggcttggaaaaaattagtccaa
tctcgcacactcacaatggacacattattttcaattagcactatttctgttcttgttgtg
tcgcttgcttcattctttgtaccatggttgcctatgatgtttgaggcaggattacttatt
tatggattcaggcatattggtatcgctattgaggacactatcaaagacaaaataagctcc
gccaaatttcaagacagagccccgcaaaaagtcagattatatcgccatcctgactttaaa
aaaacgaggattgatgagattcaacccaacgacattatacaagtcaaaccgggtgagctt
ataccattggatagcgtttgtgagcaagacaccctcatttatcccaccatcattaccggt
gctgtcatacctaaacaatttcgtagtggtgaaaaaatacttgccggaatgcgtctggca
aatgatgcaaaaccactcagcctccgcgttctaaaaactgcaaaagagtcataccttgcc
cgtcttgatgaaagcatagctcaatctgtacttgaaaaagcaccgatagaggtaaaaaca
gggcagcttcttagctattttatcccatccattattgctctctccatcctttcagggatc
attgtcggcttgattgccacaccagcacttgcgatacaatgcgctatttcagtattggtt
tctgcttgtccttgtacgcttggtttaattattcctctagcagtaaaaactggaattcat
aaaggagccgaacacggtgtgcagtttaaaaattccagggtattacaattagcagaacaa
attgatgtagtcatttttgacttgaatggtacgttaacaaccggcgttcctgtggttaaa
gaatatgctgtattaaatgatgctgatctttcttctgagcaatttctgagtatttgcaat
gtgttggaagaacaatcaaaacaccctttcggcaaagcaatacaatcgtttacccaagga
atcaataaacaaaaattcaatattgctaatttggatcattcgaaccattcaggcgtttca
gcagagattaatggtattcaatatactattggcagtaaaaccttaatgcaggaaataggg
atttctacattttcgcttgaaaaccaaatgaatctggttgcgggcgatagcctagtgttt
ctagccagaaacaaacaactattaggttatctggtcatcaccgaccccttacgaaaagat
gcaaagcaaacagttgatgctttaattaaaatgggaaaagaagtgcatctatgcactggt
gcagatgaaaaaaccgcctatcgctatgcgcaagctcttggcattaagaaggtacatgct
aattgtgtcgctacaactatcaatacagaggatagatccaaaccggtttatattaaatca
ttacaaaatcagggactaaaagtagctatgattggagatgcggctaatgacgcaaacgcc
cttgctgctagtgacttcggtatagctgtactgtctcaagacagcgatgaaatcacccag
caacacgcctcagccattatacaaagtggaactatattgcctatagccaatgcctttgcc
atatcaaaacaaacagtaaacaatatcaaccagaatttgttaattagcttagggtacaat
ttgacaacagtattaatagccggcggtctgctagtcgcccttggttttgtgctaaaccct
gctgttggtgtggcattaatggtaacccaggcttgttttgtcttgctcaatgtataccgc
tttaaagagcaacccttgcaacatttgcaagacaaagttcaggaaaaaccagaaccggct
ccttcttcttatgaggccatgaaaaagcattcacccaatttccatacagctcccgagatt
aatcattcgcaagccattcaatctggaaagcaaccaaccaataaaaataaatcaccttcc
ttttggagtgattattttcctgaattatttgaggaagaaaaggacacaagtaccgaacac
ctaatgaataacaaaataggataa

DBGET integrated database retrieval system