KEGG   Legionella pneumophila Paris (serogroup 1): plpp0026
Entry
plpp0026          CDS       T00209                                 

Definition
(GenBank) hypothetical protein
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
lpp  Legionella pneumophila Paris (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpp02044]
    plpp0026
Secretion system [BR:lpp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   plpp0026
SSDB
Motif
Pfam: TrbI Phage_Mu_Gam Cytochrom_B562
Other DBs
NCBI-ProteinID: CAH17203
Pasteur: plpp0026
Position
pLPP:20609..22063
AA seq 484 aa
MMKSFKKLIKKSKKANLNQSAKMEQLRNGLAFLLLGGLCYGFYLYSSKPQSTLPTNKKPV
FDGVLDSAFSKLSDEAVLEKQQRQIDALKALVEKNKKNTPNKSDDLVSENQALLSAMQKQ
LEQLALENKEINGKLQVALLKNSQTSLAAVAPRPPTREEIEARHKQRILDEKAYYGKAGL
ETVHFNYRRQQKEERTPDNYVWAGTHAEGILLSGAKGDAGINGAKNMGTALIRLDSNGIM
PNNRHSRLNGCLAIVSTYGDLSDDAVVMHLETLSCAKPNLSFEQKVYGAVYDLDAMQDLR
GTSILKTKPLLEYSAAAGILAGFGDGLKNLNTAQTINPGAGTITTYGQASTLMQSAAGGA
VSNPANKISDYIMKIADIYHPLVVARAGRRVSIMFTKGFWIDRAHQSFESGKSIDNQSAQ
NEAAITTTISRAGGEGGESSSGESTAPQSTFQSDTQTAQQFLNQNGMPNQPLFSTVNPTG
DVHG
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgatgaaatcgtttaaaaagttaataaagaaaagtaaaaaagctaatcttaatcaaagt
gccaaaatggagcagctccgtaatggcttggcttttctgctgcttggtggtttgtgttat
ggattttatctgtattcgtcaaagccacaatctacgcttcctacaaataaaaaacctgta
tttgatggggtattagacagcgcctttagcaaattaagtgatgaggcagtgcttgaaaaa
caacaacgccaaattgatgcactcaaagccttggtagaaaaaaataaaaagaacacacca
aacaaatcagacgacctcgtttccgaaaatcaagccttattaagcgccatgcaaaaacaa
ttagagcagcttgcgcttgaaaataaagaaatcaacggcaaactacaggtggcgttgctt
aaaaattcacaaaccagtttagctgctgtggctccaagaccgcctacacgtgaagaaata
gaggctcgtcataaacaacggattttggatgaaaaagcctattatggcaaagcaggtctt
gaaacggttcattttaattaccgtcgtcaacaaaaagaagagcgtacaccggataattat
gtatgggcaggaacccatgctgagggcattttactgagcggggccaaaggggatgctggg
attaatggtgctaaaaatatgggaacggcactgattcgactggattctaatggaattatg
cccaacaatcgccattcacgccttaatggctgccttgctattgtctctacgtatggtgat
ttgtccgatgatgcagtagtgatgcaccttgaaaccctttcgtgtgcgaaacctaattta
agttttgaacaaaaggtgtatggcgcagtgtatgacttggatgcgatgcaagacttacgc
ggtacatccattttaaaaaccaaacctcttttagaatacagtgcggctgcagggatttta
gcaggctttggggatgggcttaaaaacctcaatacagctcagaccattaatccaggcgca
ggcaccattacgacttatggtcaggcctctacgctgatgcaatcagcagcaggaggggcg
gtgagtaatccggccaataaaatctccgactacatcatgaaaatcgccgatatttatcac
cctctggtggtggcacgtgcaggacggcgtgtatccatcatgttcaccaaaggcttttgg
attgatagggcgcaccaatcgtttgaatcgggtaaatccattgataatcaatcggctcaa
aatgaggccgcgattacaacaaccattagccgagcaggcggtgaaggtggggagagtagc
agtggagagtcaactgctccgcaatccacgttccaatccgatacgcaaacggcacagcaa
tttttaaatcagaacgggatgcccaatcaaccactcttttcaacagttaatcctacagga
gacgtacatggttaa

DBGET integrated database retrieval system