KEGG   Lactobacillus paracasei N1115: AF91_02130Help
Entry
AF91_02130        CDS       T03050                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
lpq  Lactobacillus paracasei N1115
Pathway
lpq00670  One carbon pool by folate
lpq01100  Metabolic pathways
lpq01120  Microbial metabolism in diverse environments
lpq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AF91_02130
Enzymes [BR:lpq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AF91_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR DUF4148
Motif
Other DBs
NCBI-ProteinID: AHJ32037
Position
complement(420704..421576)
Genome map
AA seq 290 aa AA seqDB search
MKINQCFKDHQVISFEVFPPRKNASNIALTPILNTLDAVKEADPDFVSVTFGANGNKPHM
GTLEVAKLIKDEFDMEPVAHLPAAQLTREQVDAELRGFQDAGIDNILALRGDIPKSGRVS
NDFPYACDLIEHIHQVGDFNVVAACYPEKHPESPDVVSDIHHLKEKVDSGASQLISQLFF
DNQVFYRFRERAQLAGINVPIEAGIMPVINEHQIERMATMAGVNLPPKFVAMMQHFSGNK
EAMRDAGIAYAIDQIVDLLVHGVDGIHIYTMDNPTVVKRIAAATQTIRNA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaccagtgctttaaagatcatcaagtcatctcatttgaagttttccccccg
cgcaaaaatgcgagcaatattgctttgactccgattctcaacaccctcgatgcggtcaaa
gaagccgatcctgacttcgtttccgtaaccttcggcgccaatggcaacaagcctcacatg
gggacactcgaagttgccaaactgattaaagatgagtttgatatggaacccgtggcccat
ctgccagccgctcaactcacccgagaacaggtagatgcagaactgcgcggttttcaagat
gctggcattgacaacatccttgctttacgcggtgatatacccaaaagcggccgcgttagt
aacgattttccctatgcctgtgatctgatcgaacacattcaccaagttggcgacttcaac
gtagtagcagcctgctatccagaaaaacatcctgaatctcctgatgtggtcagtgatatt
caccatctcaaagaaaaagtcgactccggtgcaagccaactgatcagtcaacttttcttc
gacaatcaggttttttatcgatttcgcgaacgagcacaattagccgggatcaacgtgcct
atcgaagccggcattatgccagtgatcaatgaacaccagatcgaacggatggccaccatg
gccggtgtcaacttgccaccaaaatttgtcgcaatgatgcagcatttttctggcaataaa
gaagcgatgcgtgatgctggtattgcctacgcgattgatcaaattgtcgatttgctggtg
catggcgttgatgggattcatatctacacgatggacaatccaaccgtcgtcaagcgcatt
gctgctgcgactcagacgattcggaatgcttaa

DBGET integrated database retrieval system