KEGG   Lactobacillus paracasei N1115: AF91_04945Help
Entry
AF91_04945        CDS       T03050                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpq  Lactobacillus paracasei N1115
Pathway
lpq00071  Fatty acid degradation
lpq00072  Synthesis and degradation of ketone bodies
lpq00280  Valine, leucine and isoleucine degradation
lpq00310  Lysine degradation
lpq00362  Benzoate degradation
lpq00380  Tryptophan metabolism
lpq00620  Pyruvate metabolism
lpq00630  Glyoxylate and dicarboxylate metabolism
lpq00640  Propanoate metabolism
lpq00650  Butanoate metabolism
lpq00900  Terpenoid backbone biosynthesis
lpq01100  Metabolic pathways
lpq01110  Biosynthesis of secondary metabolites
lpq01120  Microbial metabolism in diverse environments
lpq01130  Biosynthesis of antibiotics
lpq01200  Carbon metabolism
lpq01212  Fatty acid metabolism
lpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AF91_04945
   00630 Glyoxylate and dicarboxylate metabolism
    AF91_04945
   00640 Propanoate metabolism
    AF91_04945
   00650 Butanoate metabolism
    AF91_04945
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AF91_04945
   00072 Synthesis and degradation of ketone bodies
    AF91_04945
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AF91_04945
   00310 Lysine degradation
    AF91_04945
   00380 Tryptophan metabolism
    AF91_04945
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AF91_04945
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AF91_04945
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AF91_04945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpq04147]
    AF91_04945
Enzymes [BR:lpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AF91_04945
Exosome [BR:lpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AF91_04945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHJ32545
Position
984899..986080
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggcgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgttagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system