KEGG   Lactobacillus paracasei N1115: AF91_10230Help
Entry
AF91_10230        CDS       T03050                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
lpq  Lactobacillus paracasei N1115
Pathway
lpq00473  D-Alanine metabolism
lpq01100  Metabolic pathways
lpq01503  Cationic antimicrobial peptide (CAMP) resistance
lpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AF91_10230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AF91_10230
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    AF91_10230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lpq01504]
    AF91_10230
Enzymes [BR:lpq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     AF91_10230
Antimicrobial resistance genes [BR:lpq01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    AF91_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AHJ33518
Position
complement(2017232..2017477)
Genome map
AA seq 81 aa AA seqDB search
MADEAIKNGVLDILADLTGSDDVKTNLDLNLFETGLLDSMGTVQLLLELQSQFGVEAPVS
EFDRSQWDTPNKIIAKVEQAQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaagcaattaaaaatggtgttttagatattttggcagatttaaccggttct
gatgatgtgaagacaaatttggatctgaatctgtttgaaaccggcttgttagattcaatg
gggacggtacaactgttgttggaactgcaaagccagttcggcgtagaagcacctgtttct
gaatttgatcgtagtcaatgggatacccctaacaaaatcatcgcaaaggtcgaacaagca
caatga

DBGET integrated database retrieval system