KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0196Help
Entry
LBP_cg0196        CDS       T02670                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00480  Glutathione metabolism
lpr00590  Arachidonic acid metabolism
lpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LBP_cg0196
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBP_cg0196
Enzymes [BR:lpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LBP_cg0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGL62942
Position
207480..207965
Genome map
AA seq 161 aa AA seqDB search
MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVV
LGLPSNQFHQEKADDDETHDYCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIK
WNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSED
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcagtgtatgattttacagaaactgagatgagtggtgcgccacttgacttg
tcacaatatcgcggtcaggtcttgctaatcgtgaatacggctagcaactgtggcctggcg
ccacagtttaaaggattagaagaactttatcagaagtatcagcaggagggcctagtggtc
ttgggattgccatccaatcaatttcatcaagaaaaggcggatgacgatgagacccatgac
tattgtcaacggcactacggggtaacgttccccatgaccaaacgggtgatggttaatggt
gatgacgctgatccgttatttacttacctcaaacaggcggcgggacatggtcgaatcaag
tggaatttcacaaaattcctgattggtcgtgatggccgtgtgctcgaacgctatgcccca
acgacacggccggcaacatttgaagcagcgattcgtgatgccttggctgatcgttcagaa
gattaa

DBGET integrated database retrieval system