KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg0954Help
Entry
LBP_cg0954        CDS       T02670                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00030  Pentose phosphate pathway
lpr00480  Glutathione metabolism
lpr01100  Metabolic pathways
lpr01110  Biosynthesis of secondary metabolites
lpr01120  Microbial metabolism in diverse environments
lpr01130  Biosynthesis of antibiotics
lpr01200  Carbon metabolism
Module
lpr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lpr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBP_cg0954
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBP_cg0954
Enzymes [BR:lpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     LBP_cg0954
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     LBP_cg0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD IlvN F420_oxidored 2-Hacid_dh_C Rossmann-like NAD_binding_11 CoA_binding GFO_IDH_MocA TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGL63700
Position
complement(989234..990130)
Genome map
AA seq 298 aa AA seqDB search
MKLGLIGLGKMGMNLALNMQDNGHTPVGMDLNPTNLSTASAHGLATATDLTNLLDQLPTP
RIVWIMVPAGKATNSVIEQLAQTLSAGDIVLDGGNSHYQDSIRHGELLASHHINFLDVGT
SGGQAGARHDGNFMIGGDLATFQVVEPLFKAIAAPDGYLYTGPVGSGHYLKMVHNGIEYG
MMAAIGEGFDVLQHSQFTYDNAAVAKMWNNGSVIRSWLMGLAQDAFSKDGNLDDIKGVMH
SSGEGRWTLDTALDQQVATPVIAMALMMRYRSETDDTFTGKVVAALRNEFGGHAVDHE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggattgattggcttaggtaaaatgggaatgaacttagcgttgaacatgcag
gataacgggcacacgccagtgggaatggatcttaaccccactaatcttagtaccgccagt
gctcacgggttggcgacggccacggatctcaccaatttgcttgaccagttgccaacacca
cggatcgtgtggatcatggtacccgctggtaaggcaaccaacagcgttatcgaacagtta
gcccagactttaagtgcaggtgacatcgtcctcgatggcggtaattcgcactatcaagat
agtatccgccacggcgaattactggcaagtcaccacatcaacttcttagacgtcgggacg
tcgggcggtcaagctggtgcacgccacgacggcaattttatgattggtggcgacctcgcc
actttccaagtcgtcgaaccactatttaaagcgattgccgctcccgatgggtatttgtac
accggccctgttggcagtggtcattacctgaagatggtccacaacggaattgagtatggt
atgatggcagcaataggtgaaggctttgacgttttacagcatagtcagttcacttacgac
aacgcggccgtcgccaaaatgtggaataacggctcagtcattcgcagctggttaatgggc
ttagctcaagatgcattcagcaaggatggtaatctagatgacatcaagggtgttatgcat
tcatccggtgaaggtcgctggaccttagacacggccctagaccaacaagtcgccaccccg
gtcattgcgatggccttgatgatgcgctaccgttcagaaaccgatgacacattcactggt
aaagttgttgccgccctgcgtaacgagtttggtggccacgctgtcgatcacgaatag

DBGET integrated database retrieval system