KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg1807Help
Entry
LBP_cg1807        CDS       T02670                                 

Definition
(GenBank) rRNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lpr03009]
    LBP_cg1807
Enzymes [BR:lpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     LBP_cg1807
Ribosome biogenesis [BR:lpr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LBP_cg1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 MetW DUF2512 Arb1
Motif
Other DBs
NCBI-ProteinID: AGL64553
Position
complement(1859105..1859959)
Genome map
AA seq 284 aa AA seqDB search
MKKIDRGIQFVQANIDRFRCLVCNQAYVTIDGHSLCCPNGHQVDFSKKGTLYFLTHQVAS
EYDANMLAARRRVLQAGFFGPIVQAINAALPKTAQRILDIGSGEGTPLADLLTMHANSED
VGIGFDISKDGVNLATQLTTTAYYCVADLAQLPFTDGAFTAIMDVFSPSAYQEFERVLAP
GGQLLKIVPNPEYLVELRHLLFKPTDRQYQYDNQRVLDLFAQHYPTAKRQRIQYQVALDN
IDFNDLLVMTPLHWGADAEQLATAKRQGLTKITVDVSLLTMQKG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattgaccgcggcatccagtttgttcaggcaaatatcgatcgctttcgatgc
ttagtttgtaatcaagcatacgtgacaattgacggccacagcttatgttgtcctaatggg
catcaagtagatttttcaaaaaaagggacgttgtattttctaacgcatcaagtcgctagc
gagtacgatgctaacatgctggcagcgcggcgccgagttttgcaagctggttttttcggc
cccattgtccaagccattaatgcggcattgccaaaaacggcgcaacgaatcttagatatt
ggtagcggtgaaggcacccccctagctgatttgttgacaatgcatgccaattctgaagac
gtggggattggttttgacattagtaaggatggggttaacttagcgacccaattgacgacg
actgcttattattgtgtggccgatttggcccaattaccctttaccgatggggcattcacg
gccattatggatgtcttctcaccatccgcttaccaagagtttgaacgggtccttgcgccc
ggtggacagttattgaagatcgtgccaaatcctgagtacttagttgaactgcgtcattta
ctatttaaaccgactgatcgacagtatcagtatgataatcaacgggtgttagatctgttt
gcccagcactatcccactgctaagcggcaacgaattcaataccaagttgcgcttgataac
attgactttaacgacttattagtcatgacaccgctgcactggggtgcggatgctgagcag
ctcgcaaccgctaaacggcaggggttaactaagattaccgttgatgtgagtttattaacg
atgcaaaaaggttag

DBGET integrated database retrieval system