KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2321Help
Entry
LBP_cg2321        CDS       T02670                                 

Definition
(GenBank) 2-haloacid dehalogenase (Putative)
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
lpr00625  Chloroalkane and chloroalkene degradation
lpr01100  Metabolic pathways
lpr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBP_cg2321
   00361 Chlorocyclohexane and chlorobenzene degradation
    LBP_cg2321
Enzymes [BR:lpr01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LBP_cg2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AGL65067
Position
complement(2379620..2380282)
Genome map
AA seq 220 aa AA seqDB search
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKAYATYEDDPASVNPYLDYST
LVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSS
WDIMPANIAALKVPFTAVVTAEDVQAYKPALAFFETVQERFKLTADNHWHIARGYESDVV
PASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAAKQWVN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaatatttaacatttgattgttacgggacgttaattaatactgagccgctg
tatcaatgggtggctaatttaggattggcggttggtttagacccactaacggttcgcaaa
gcctacgcgacttatgaggacgatcctgccagtgtcaatccttatctagattattcaaca
ttagtccgggctgatcttaagcatttagatcgattgtttgaacagagacacttctttgaa
agtcattacgttgaatgcttggaagtgcaacgacacttattaccatacgccgatgttata
ccgaccttaacagcgtggcagcaattgggctatcaattgattattatgtcgaattcttcc
tgggatattatgccggccaacattgctgctttaaaggtgccgttcacagcggttgttacg
gctgaagacgttcaagcttacaaaccagcgttagctttctttgaaacggttcaagagcgt
tttaagttaacggcagataatcattggcatattgcacgtggctatgaatccgatgttgtt
ccagccagtgctatgcagtggccgatgatttggattaatcgtgatcagcgacaaccgact
agttctgaacggccgacccatatggttactgatttggccgctgctaagcagtgggttaac
tag

DBGET integrated database retrieval system