KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1216Help
Entry
LPST_C1216        CDS       T01324                                 

Gene name
gnd2
Definition
(GenBank) phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00030  Pentose phosphate pathway
lps00480  Glutathione metabolism
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01120  Microbial metabolism in diverse environments
lps01130  Biosynthesis of antibiotics
lps01200  Carbon metabolism
Module
lps_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lps_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LPST_C1216 (gnd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LPST_C1216 (gnd2)
Enzymes [BR:lps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     LPST_C1216 (gnd2)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     LPST_C1216 (gnd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 2-Hacid_dh_C ApbA 3HCDH_N NAD_Gly3P_dh_N IlvN F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADN98435
Position
1340923..1342359
Genome map
AA seq 478 aa AA seqDB search
MSNEKPQIGVIGMAVMGKNLALNIESRGYKVAIFNRTGAKTEKVVKDHADKQLVPSYKIE
DFVASLETPRRIIMMVKAGKPTDAVIDELLPLLDKGDVLIDGGNTNFNDTMARNARLDKS
GINFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKISAKAPQDGAPCVTYIGPNG
AGHYVKMVHNGIEYGDEELIDESYNIMRNVAGLSVDEMSDIFTDWNKGELSSYLIEITAD
ILSRKDDLGADKTKPIVDMILDRGNNKGTGKWSSEDALNVQVPQSVITEAVYARYISMMK
NERVAASKKLAGPTADVDLPAKKELVEKIRQALYFSKIMSYAQGFEQLRFASEHYGWDLK
FGELAQIWRAGCIIRAQFLQNITDAFDKKPDLNNLLMDDYFADIAAKYQQSTREVLSLAI
QAGVPVPSFSAALSYYDSYRAEVLPANLLQAQRDYFGAHTYERTDREGLYHYSWYEEQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaaaaccacaaattggtgtcattgggatggccgtcatgggtaagaacctg
gcgttgaacatcgaaagccgcggctacaaggttgcgatttttaatcggactggtgccaaa
actgaaaaggtcgttaaggaccatgctgacaagcaattagtaccaagttataagatcgaa
gacttcgtggcttcacttgaaacgccacgacggattatcatgatggttaaggctggtaag
ccaaccgatgccgttatcgatgaattattaccactattagataaaggcgacgtcttgatt
gatggtgggaacaccaactttaatgacacgatggcgcgtaacgcccgcttagataaatcc
ggaatcaactttattggtatgggtgtttccggtggtgaattaggtgccttacaaggccct
tcattgatgcctggtggtcaaaaggaagcttatgatttagttgccccaatcttggaaaag
atttctgctaaagcgcctcaagacggtgcaccatgtgtgacttacatcggcccgaacggt
gctggtcactacgttaagatggtccacaacgggattgaatacggtgatgaagagttaatc
gatgaatcatacaatatcatgcgcaacgtcgcgggcttgtccgttgatgaaatgtccgat
atttttacggactggaacaaaggcgaattgagcagttacttgatcgaaatcaccgctgac
attttgtcacgtaaggatgatttaggtgcggataagactaagccaatcgttgacatgatc
ttagaccgtgggaacaacaaaggaactggtaagtggagttccgaagatgccttgaacgtt
caagtgccacaatccgttattacggaagcggtctatgcgcgttacatctcaatgatgaag
aacgaacgggttgccgcttctaagaaattagctggcccaaccgctgacgttgacttgcca
gccaagaaagaattggttgagaagattcgtcaagccctctacttcagtaagattatgagt
tatgcgcaaggcttcgaacaacttcgtttcgcttctgaacattatggttgggacttgaag
ttcggtgaacttgcccaaatctggcgtgctggttgtatcatccgggcccaattcttacaa
aacatcacggatgcttttgataagaagcctgatttaaataacttattgatggacgactac
tttgccgacatcgccgccaagtatcaacaatcaacacgtgaagtgcttagcttagcaatc
caagctggtgtaccggtaccatcatttagtgcggcattgtcatactacgactcataccgg
gccgaagtgttacctgctaacttgttgcaagcgcaacgggactactttggtgcgcatacg
tatgaacggactgaccgtgaagggttataccattacagttggtacgaagaacaataa

DBGET integrated database retrieval system