KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1243Help
Entry
LPST_C1243        CDS       T01324                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00010  Glycolysis / Gluconeogenesis
lps00052  Galactose metabolism
lps00500  Starch and sucrose metabolism
lps00520  Amino sugar and nucleotide sugar metabolism
lps00521  Streptomycin biosynthesis
lps01100  Metabolic pathways
lps01110  Biosynthesis of secondary metabolites
lps01120  Microbial metabolism in diverse environments
lps01130  Biosynthesis of antibiotics
lps01200  Carbon metabolism
Module
lps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPST_C1243 (glk)
   00052 Galactose metabolism
    LPST_C1243 (glk)
   00500 Starch and sucrose metabolism
    LPST_C1243 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LPST_C1243 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LPST_C1243 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LPST_C1243 (glk)
Enzymes [BR:lps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LPST_C1243 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADN98462
Position
1372624..1373586
Genome map
AA seq 320 aa AA seqDB search
MERKLIGVDLGGTTTKFAILTENGDIQQKWSIETTILDEGAHIVPNIIDSINHHIELYKM
DRSQFIGIGMGTPGTVDLDNGTVIGAYNLNWKTLQPVKAQIEKGTGIKFTLDNDANVAAL
GERWKGAGENGSDVVFVTLGTGVGGGIIADGRLLHGIAGGAGEIGHVTVEPNGYMCTCGK
KGCLEQYASATGVVHVARDMAEEFSGASKLKQLLDNGEEISSKITFDLAKEGDVLAKRVV
DRVSYYLGLALANVGNTMNPSSIIIGGGVSAAGDFLLDQVISYFNQFTFPTIRDTTALKL
AVLGNDAGVIGAGSLAQRFI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaagttaatcggagtcgaccttggtgggacgacaactaagtttgccatttta
acagaaaatggtgatattcaacaaaagtggagtattgaaaccacgattttagatgaaggg
gcccacattgtgcctaacatcatcgattccatcaaccaccacattgagttatataagatg
gaccgttctcaatttatcggaattggaatggggactcccgggaccgttgatttggataat
ggtacggttatcggtgcctacaacttaaactggaagaccttacaaccagttaaggctcaa
atcgaaaaagggactggcatcaaatttacgctggataacgacgctaacgttgctgcactt
ggcgaacgttggaagggcgctggcgaaaacggtagtgacgttgtctttgtaacgcttgga
actggtgttggcggtgggatcatcgccgatggccgtttactccatggtattgccggtggt
gccggtgaaattggtcacgtaacggttgaaccaaacggctacatgtgtacttgtggtaag
aaaggttgtttggaacaatacgcttctgcaactggtgtcgttcacgttgctcgcgatatg
gcagaagaattctctggtgcttctaagttgaaacaattattagacaacggtgaagaaatt
agttcaaagatcactttcgatttagctaaagaaggcgatgtcttggctaaacgcgttgtt
gatcgggtttcttattacttaggcttggcattagctaatgtcgggaacacgatgaaccca
tcttcaatcattatcggtggtggggtttcagctgctggtgatttcttattagatcaagtc
atcagttactttaaccaattcacattcccaacgattcgcgacacgactgctttgaagtta
gcggtcttaggtaacgacgctggtgttatcggagcaggttcattggcccaacggtttatt
taa

DBGET integrated database retrieval system